Os06t0194900-04

Locus

Os06g0194900

Description

Similar to Sucrose synthase 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RSUS2

CGSNL Gene Name

SUCROSE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

sus2, RSus2(t), SUS2, SS1, OsScS1, RSs1, RSus2, OsSUS2, RSS1, RSus1, OsSusy2, Susy2

Oryzabase Gene Name Synonym(s)

sucrose synthase2, Sucrose synthase 2, Sucrose synthase 1, Sucrose-UDP glucosyltransferase 2, Sucrose synthase-1, rice SuSy gene 1, sucrose-UDP glucosyltransferase isozyme 1, sucrose synthase l, rice sucrose synthase-1

Transcript Evidence

AK119193 (DDBJ, Best hit)

Protein Evidence

A1YQI8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: sucrose metabolic process (GO:0005985)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: sucrose synthase activity (GO:0016157)

Functional domain (InterPro)

Sucrose synthase (IPR000368)

Glycosyl transferase, family 1 (IPR001296)

Sucrose synthase, plant/cyanobacteria (IPR012820)

Full-length cDNA

001-041-C01 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0194900-04)

RiceXPro (AK119193)

Others

Oryzabase (2199)

KEGG (Os06t0194900-04 (EC:2.4.1.13))

Transcript

2132 bp

>Os06t0194900-04 Similar to Sucrose synthase 2.
CACCTGTCGTCCAAGTTGTTCCAGGACAAGGAGAGCCTCTACCCCTTGCTGAACTTCCTG
AAAGCCCATAACCACAAGGGCACGACAATGATGCTGAATGACAGAATTCAGAGCCTTCGT
GGGCTCCAATCATCCCTTAGAAAGGCAGAAGAATATCTGATGGGCATTCCTCAAGACACG
CCCTACTCGGAGTTCAACCACAGGTTCCAAGAGCTCGGTTTGGAGAAGGGTTGGGGTGAC
TGTGCAAAGCGTGTGCTTGACACCATCCACTTGCTTCTTGACCTTCTTGAGGCCCCTGAT
CCGGCCAACTTGGAGAAGTTCCTTGGAACTATTCCAATGATGTTCAATGTTGTTATCCTG
TCTCCGCATGGATACTTTGCCCAATCCAATGTGTTGGGATACCCTGATACTGGTGGTCAG
gttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaag
cagcaaggccttgatatcacacctaagatcctcattgtaaccAGGCTGTTGCCTGATGCT
GTTGGTACTACATGCGGCCAGCGTGTGGAGAAGGTTATTGGAACTGAGCACACTGACATT
CTTCGTGTTCCATTCAGGAGTGAGAATGGTATCCTCCGCAAGTGGATCTCCCGTTTTGAT
GTCTGGCCATTCCTGGAAACATACACTGAGGATGTTGCAAACGAAATTATGAGGGAAATG
CAAGCCAAACCTGATCTCATCATTGGCAATTACAGTGATGGAAACCTTGTTGCCACTCTG
CTGGCTCACAAATTAGGAGTTACCCAGTGTACCATTGCTCATGCCTTGGAGAAAACCAAA
TACCCCAACTCAGACATATACTTGGACAAGTTTGACAGCCAGTACCACTTCTCATGCCAA
TTCACTGCTGATCTTATCGCCATGAATCACACTGATTTCATCATCACCAGTACATTCCAA
GAAATTGCTGGAAGCAAGGACACTGTGGGGCAGTATGAATCACACATTGCATTCACCCTT
CCTGGGCTTTACCGAGTTGTGCATGGCATAGATGTTTTTGATCCCAAGTTCAACATTGTC
TCTCCTGGAGCTGACATGAGTGTCTACTTCCCGTACACCGAGGCTGACAAGAGGCTCACT
GCTTTCCACCCTGAAATTGAGGAGCTTCTCTACAGTGAAGTCGAGAACGATGAACACAAG
TTTGTATTGAAGGACAAGAACAAGCCAATCATCTTCTCCATGGCTCGTCTTGACCGAGTG
AAGAACATGACAGGTCTGGTTGAGATGTATGGTAAGAATGCACATCTCAGGGATTTGGCA
AACCTTGTGATTGTTTGTGGTGACCACGGCAATCAGTCCAAGGACAGGGAGGAGCAGGCT
GAGTTCAAGAAGATGTACGGTCTCATTGACCAGTACAAGTTGAAGGGGCATATCCGCTGG
ATCTCAGCTCAGATGAACCGTGTTCGTAACGGGGAGTTGTACCGATACATTTGTGACACC
AAGGGAGTCTTTGTCCAGCCTGCATTCTATGAAGCGTTTGGTCTGACTGTCATCGAAGCC
ATGACATGTGGTTTGCCAACAATCGCAACATGCCATGGTGGCCCTGCTGAGATTATTGTT
GATGGGGTGTCTGGTCTGCACATTGATCCTTACCACAGTGACAAGGCTGCTGATATCTTG
GTCAACTTCTTTGAGAAGTGCAAGCAGGATTCAACCTACTGGGACAATATTTCACAGGGA
GGTCTGCAGAGGATTTACGAGAAgtacacctggaagctgtactctgagaggctgatgACC
TTGACTGGTGTATACGGATTCTGGAAGTACGTAAGCAACCTTGAGAGGCGCGAGACTCGC
CGTTACATTGAGATGTTCTATGCTCTGAAATACCGCAGCCTGGCCAGCGCCGTCCCATTG
GCTGTCGATGGAGAGAGCACATCCAAGTAATGGAGGGGAAAATATGCATCTTCAGCAGGA
GAAGCCGTCAGCTGCATTCGAATTTGATAATTTTCTGTAGTTGTCATTTGGCATCCATGT
TTGCCATGGATGTGTACTATGTCTAAGGTTTCAGTACTTTTGCGAGATTTTGGGCAGTGC
TTGCCTCAAATAAACGCCGGTTCCTGGTGTTT

CDS

1950 bp

>Os06t0194900-04 Similar to Sucrose synthase 2.
CACCTGTCGTCCAAGTTGTTCCAGGACAAGGAGAGCCTCTACCCCTTGCTGAACTTCCTG
AAAGCCCATAACCACAAGGGCACGACAATGATGCTGAATGACAGAATTCAGAGCCTTCGT
GGGCTCCAATCATCCCTTAGAAAGGCAGAAGAATATCTGATGGGCATTCCTCAAGACACG
CCCTACTCGGAGTTCAACCACAGGTTCCAAGAGCTCGGTTTGGAGAAGGGTTGGGGTGAC
TGTGCAAAGCGTGTGCTTGACACCATCCACTTGCTTCTTGACCTTCTTGAGGCCCCTGAT
CCGGCCAACTTGGAGAAGTTCCTTGGAACTATTCCAATGATGTTCAATGTTGTTATCCTG
TCTCCGCATGGATACTTTGCCCAATCCAATGTGTTGGGATACCCTGATACTGGTGGTCAG
gttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaag
cagcaaggccttgatatcacacctaagatcctcattgtaaccAGGCTGTTGCCTGATGCT
GTTGGTACTACATGCGGCCAGCGTGTGGAGAAGGTTATTGGAACTGAGCACACTGACATT
CTTCGTGTTCCATTCAGGAGTGAGAATGGTATCCTCCGCAAGTGGATCTCCCGTTTTGAT
GTCTGGCCATTCCTGGAAACATACACTGAGGATGTTGCAAACGAAATTATGAGGGAAATG
CAAGCCAAACCTGATCTCATCATTGGCAATTACAGTGATGGAAACCTTGTTGCCACTCTG
CTGGCTCACAAATTAGGAGTTACCCAGTGTACCATTGCTCATGCCTTGGAGAAAACCAAA
TACCCCAACTCAGACATATACTTGGACAAGTTTGACAGCCAGTACCACTTCTCATGCCAA
TTCACTGCTGATCTTATCGCCATGAATCACACTGATTTCATCATCACCAGTACATTCCAA
GAAATTGCTGGAAGCAAGGACACTGTGGGGCAGTATGAATCACACATTGCATTCACCCTT
CCTGGGCTTTACCGAGTTGTGCATGGCATAGATGTTTTTGATCCCAAGTTCAACATTGTC
TCTCCTGGAGCTGACATGAGTGTCTACTTCCCGTACACCGAGGCTGACAAGAGGCTCACT
GCTTTCCACCCTGAAATTGAGGAGCTTCTCTACAGTGAAGTCGAGAACGATGAACACAAG
TTTGTATTGAAGGACAAGAACAAGCCAATCATCTTCTCCATGGCTCGTCTTGACCGAGTG
AAGAACATGACAGGTCTGGTTGAGATGTATGGTAAGAATGCACATCTCAGGGATTTGGCA
AACCTTGTGATTGTTTGTGGTGACCACGGCAATCAGTCCAAGGACAGGGAGGAGCAGGCT
GAGTTCAAGAAGATGTACGGTCTCATTGACCAGTACAAGTTGAAGGGGCATATCCGCTGG
ATCTCAGCTCAGATGAACCGTGTTCGTAACGGGGAGTTGTACCGATACATTTGTGACACC
AAGGGAGTCTTTGTCCAGCCTGCATTCTATGAAGCGTTTGGTCTGACTGTCATCGAAGCC
ATGACATGTGGTTTGCCAACAATCGCAACATGCCATGGTGGCCCTGCTGAGATTATTGTT
GATGGGGTGTCTGGTCTGCACATTGATCCTTACCACAGTGACAAGGCTGCTGATATCTTG
GTCAACTTCTTTGAGAAGTGCAAGCAGGATTCAACCTACTGGGACAATATTTCACAGGGA
GGTCTGCAGAGGATTTACGAGAAgtacacctggaagctgtactctgagaggctgatgACC
TTGACTGGTGTATACGGATTCTGGAAGTACGTAAGCAACCTTGAGAGGCGCGAGACTCGC
CGTTACATTGAGATGTTCTATGCTCTGAAATACCGCAGCCTGGCCAGCGCCGTCCCATTG
GCTGTCGATGGAGAGAGCACATCCAAGTAA

Protein

650 aa

>Os06t0194900-04 Similar to Sucrose synthase 2.
HLSSKLFQDKESLYPLLNFLKAHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDT
PYSEFNHRFQELGLEKGWGDCAKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVIL
SPHGYFAQSNVLGYPDTGGQVVYILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDA
VGTTCGQRVEKVIGTEHTDILRVPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREM
QAKPDLIIGNYSDGNLVATLLAHKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQ
FTADLIAMNHTDFIITSTFQEIAGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIV
SPGADMSVYFPYTEADKRLTAFHPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRV
KNMTGLVEMYGKNAHLRDLANLVIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRW
ISAQMNRVRNGELYRYICDTKGVFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIV
DGVSGLHIDPYHSDKAADILVNFFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMT
LTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASAVPLAVDGESTSK*

CDS

chr06:4800114..4800197 (- strand) : 84 bp

chr06:4799846..4799964 (- strand) : 119 bp

chr06:4799534..4799750 (- strand) : 217 bp

chr06:4799356..4799451 (- strand) : 96 bp

chr06:4799086..4799259 (- strand) : 174 bp

chr06:4798885..4799001 (- strand) : 117 bp

chr06:4798636..4798802 (- strand) : 167 bp

chr06:4798323..4798547 (- strand) : 225 bp

chr06:4797665..4797983 (- strand) : 319 bp

chr06:4797290..4797534 (- strand) : 245 bp

chr06:4797040..4797178 (- strand) : 139 bp

chr06:4796895..4796942 (- strand) : 48 bp

3'UTR

chr06:4796713..4796894 (- strand) : 182 bp

FASTA

>Os06t0194900-04 class=Sequence position=chr06:4796713..4800197 (- strand)
CACCTGTCGT CCAAGTTGTT CCAGGACAAG GAGAGCCTCT ACCCCTTGCT GAACTTCCTG AAAGCCCATA ACCACAAGGG
CACGGTAAGC TTCCAATTTG TGGAACATAC CAAATGCTTT TATACTAGAT GTTTTTTCTT GTGTGAATTG CTTTAAATGT
TAGTCCTTTA GAAACCCACT TGACATTCTC TGTAAGTTCC ACCAAATGAC GGGATCCGAA TTTTCTATTA CAGACAATGA
TGCTGAATGA CAGAATTCAG AGCCTTCGTG GGCTCCAATC ATCCCTTAGA AAGGCAGAAG AATATCTGAT GGGCATTCCT
CAAGACACGC CCTACTCGGA GTTCAACCAC AGGTGATTAC TTTATTATTT CTCCTTATCA TATAGCCCAT GTTATACTAC
TGCAAATGGA ATAATTCCTT ACAATGTGAT TCATGATTTG AATACAGGTT CCAAGAGCTC GGTTTGGAGA AGGGTTGGGG
TGACTGTGCA AAGCGTGTGC TTGACACCAT CCACTTGCTT CTTGACCTTC TTGAGGCCCC TGATCCGGCC AACTTGGAGA
AGTTCCTTGG AACTATTCCA ATGATGTTCA ATGTTGTTAT CCTGTCTCCG CATGGATACT TTGCCCAATC CAATGTGTTG
GGATACCCTG ATACTGGTGG TCAGGTAGAG CTTTTTAACA AATTTTCCCC TTATATACAG TACTTCAAAT ATTTCTAGTT
TTGACCTGTT ATTCTGTTGt ttgcaggttg tgtacatttt ggaccaagtc cgcgctttgg agaatgagat gcttttgagg
atcaagcagc aaggccttga tatcacacct aagatcctca ttgtatgttc aagatgttgg tcttgaatgt ttcaagtttt
aaacacttct cagtgcgaat tgtagagtaa cgtgcggaca tgattttact tgatgcaggt aaccAGGCTG TTGCCTGATG
CTGTTGGTAC TACATGCGGC CAGCGTGTGG AGAAGGTTAT TGGAACTGAG CACACTGACA TTCTTCGTGT TCCATTCAGG
AGTGAGAATG GTATCCTCCG CAAGTGGATC TCCCGTTTTG ATGTCTGGCC ATTCCTGGAA ACATACACTG AGGTAAATGG
TTTATCTGAC AACGTCCTTC AGAGCTGAGC ACAAACCATG AATTCTGAGA GCTCATCTTT TTTTTTTTGG TTGCAGGATG
TTGCAAACGA AATTATGAGG GAAATGCAAG CCAAACCTGA TCTCATCATT GGCAATTACA GTGATGGAAA CCTTGTTGCC
ACTCTGCTGG CTCACAAATT AGGAGTTACC CAGGTATGTT TGGTTGTAAA CCACTCCTTT AAATATTTCT TTCATTAAGT
CAATTACTTA TGATTTCTCT TCTACATGGA TACAGTGTAC CATTGCTCAT GCCTTGGAGA AAACCAAATA CCCCAACTCA
GACATATACT TGGACAAGTT TGACAGCCAG TACCACTTCT CATGCCAATT CACTGCTGAT CTTATCGCCA TGAATCACAC
TGATTTCATC ATCACCAGTA CATTCCAAGA AATTGCTGGA AGGTAAAATT TTCTAAAGAG CAGTAGAATA TTGCTGCGTT
GTGCCAACAC CTAAACGGGT ATCTGATGTT TGTTTCCTCT GTTTCTTCAG CAAGGACACT GTGGGGCAGT ATGAATCACA
CATTGCATTC ACCCTTCCTG GGCTTTACCG AGTTGTGCAT GGCATAGATG TTTTTGATCC CAAGTTCAAC ATTGTCTCTC
CTGGAGCTGA CATGAGTGTC TACTTCCCGT ACACCGAGGC TGACAAGAGG CTCACTGCTT TCCACCCTGA AATTGAGGAG
CTTCTCTACA GTGAAGTCGA GAACGATGAA CACAAGTGAG TACTGAACTG CTGGTTCCGT CCCTGTTATT CACCTACCAT
GTAACAAATA ATTAAACACT GATTTGTGTG TTTGGTCTAG CTTTGGCTCT TCAGTCTACT AAGTGCCATG CACTAGAACT
TTGTAGATTT GAACTGCAAT TCTTAATTTT CTCACTCCTT AGTAGACCAC AATAATAATT ATTGTGTCTG ACCCAGCTAG
TTTACAATAG TGACTTCAAT GCTTGTTTTT TCCCCTTGAA CAATTGTTTA CTTTCTAGCA GTGGAGTTTG GCATCTAAAC
TTGAATACAC GCTGTTCTTT TTTGTGTATA AAATGTTTAT TTAATGTTCT GCAGGTTTGT ATTGAAGGAC AAGAACAAGC
CAATCATCTT CTCCATGGCT CGTCTTGACC GAGTGAAGAA CATGACAGGT CTGGTTGAGA TGTATGGTAA GAATGCACAT
CTCAGGGATT TGGCAAACCT TGTGATTGTT TGTGGTGACC ACGGCAATCA GTCCAAGGAC AGGGAGGAGC AGGCTGAGTT
CAAGAAGATG TACGGTCTCA TTGACCAGTA CAAGTTGAAG GGGCATATCC GCTGGATCTC AGCTCAGATG AACCGTGTTC
GTAACGGGGA GTTGTACCGA TACATTTGTG ACACCAAGGG AGTCTTTGTC CAGGTATATA CATACGCTGT CATATTCTAC
TGCTATATTT CTATTCTGAG CTTCCAGTAG CAAATGATTT CTACTATTTG TAAAGAACAG CCTTGTGCTT GAGACTAAAA
CTGCTTTTAA AATTGTTTTT TAGCCTGCAT TCTATGAAGC GTTTGGTCTG ACTGTCATCG AAGCCATGAC ATGTGGTTTG
CCAACAATCG CAACATGCCA TGGTGGCCCT GCTGAGATTA TTGTTGATGG GGTGTCTGGT CTGCACATTG ATCCTTACCA
CAGTGACAAG GCTGCTGATA TCTTGGTCAA CTTCTTTGAG AAGTGCAAGC AGGATTCAAC CTACTGGGAC AATATTTCAC
AGGGAGGTCT GCAGAGGATT TACGAGAAGT ATGTATTTCA TGATCTGCAA ATATATAACA TTTTTTTTTT ACGATTGACA
TATAACTGTA GAAATCATGT GTCCAATCTA TATTGATCCT ACAAATTTGG Acttgtcagg tacacctgga agctgtactc
tgagaggctg atgACCTTGA CTGGTGTATA CGGATTCTGG AAGTACGTAA GCAACCTTGA GAGGCGCGAG ACTCGCCGTT
ACATTGAGAT GTTCTATGCT CTGAAATACC GCAGCCTGGT AAGTTACTCT CGCTGTTCAA CAGCTTGTTA ATTTCAGTAT
TATTGCACTG AGCATATCTC TGAATTCTGT TGCTACATTT CTTTGTTGAA TCCAGGCCAG CGCCGTCCCA TTGGCTGTCG
ATGGAGAGAG CACATCCAAG TAATGGAGGG GAAAATATGC ATCTTCAGCA GGAGAAGCCG TCAGCTGCAT TCGAATTTGA
TAATTTTCTG TAGTTGTCAT TTGGCATCCA TGTTTGCCAT GGATGTGTAC TATGTCTAAG GTTTCAGTAC TTTTGCGAGA
TTTTGGGCAG TGCTTGCCTC AAATAAACGC CGGTTCCTGG TGTTT

Locus: Os06g0194900

Loading...

Locus: Os06g0194900

Loading...