Os06t0203800-01

Locus

Os06g0203800

Description

Receptor-like kinase, Heat tolerance

RAP-DB Gene Symbol Synonym(s)

RLCK204, OsRLCK204, OsER1, ER1

RAP-DB Gene Name Synonym(s)

RECEPTOR-LIKE CYTOPLASMIC KINASE 204, Receptor-like Cytoplasmic Kinase 204, ERECTA 1

CGSNL Gene Symbol

RLCK204

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 204

Oryzabase Gene Symbol Synonym(s)

OsRLCK204, OsER1, ER1

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 204, ERECTA 1

Transcript Evidence

AK073793

Protein Evidence

Q69SP5

Literature

PMID: 26280413

PMID: 19825577

Note

Manual Curation

September 9, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J033070P05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0203800-01)

RiceXPro (AK073793)

Others

Oryzabase (18901)

KEGG (Os06t0203800-01)

Transcript

3673 bp

>Os06t0203800-01 Receptor-like kinase, Heat tolerance
GATGTGACATCTCAGTGTCCATCGGCCATCGCCTCCTTTTCTCTCTCCTCTCCTCTCACC
ATCTTCTCCTACAGCAAATCACTCTTCTCTCTCTCTAAAAAACTTCACAAGCCTACTAGC
CTACTACTAGGCACGTAGCTAGCCCCTGCCACTCTATCGCCCAGCACAAGCCATACAGCT
ACCCGCTGTCACTGCGCCAGCGGCCGCAGCTGCGCAAAGAGGAGCGCGAGAACCCAAGAA
ACCAACCAAGAGCTGCGTCCCATAAAGGCGCGCTGCTTCAATCCATCCATCTTCTGATCT
TCCATATACTTCGCTTCCTGTAAATGTCATCGCCGCCCCGGCGGTGCCTCGCAGCGGAGC
AGCAGTGGCCATGACGCCGGCGCCGGCGGCCGCCTCCTACCGCGCTCTCGTCGCGCTCCT
GCTCGTCGCCGTCGCCGTTGCCGATGATGGGTCGACGCTGCTGGAGATCAAGAAGTCCTT
CCGCAATGTGGACAACGTACTGTACGATTGGGCCGGCGGCGACTACTGCTCGTGGCGCGG
CGTCCTCTGCGACAACGTCACCTTCGCCGTCGCCGCGCTCAACCTATCCGGGCTCAACCT
CGGAGGCGAGATCTCTCCGGCCGTCGGCAGGTTGAAGGGCATCGTCTCGATTGACTTGAA
GTCGAATGGGCTGTCTGGGCAGATCCCTGATGAGATTGGCGATTGTTCATCACTAAAAAC
TCTGGATTTGTCTTTCAATAGCTTGGATGGGGACATTCCGTTCTCAGTATCGAAGCTGAA
GCACATTGAGAGCTTGATATTGAAGAACAACCAACTGATCGGAGTGATCCCATCAACGCT
CTCACAGCTCCCAAATTTGAAGATTTTGGACTTGGCACAGAACAAACTGAGTGGAGAGAT
ACCAAGACTGATATATTGGAACGAGGTTCTTCAATACTTGGGATTACGCGGTAATAATTT
AGAAGGCAGCATCTCCCCAGATATATGCCAGTTGACTGGGCTTTGGTACTTTGACGTAAA
GAACAACAGCTTGACTGGGCCGATACCAGAAACCATTGGGAACTGTACAAGTTTTCAGGT
CTTGGATTTGTCTTACAATAAACTTTCTGGATCAATTCCTTTCAACATTGGTTTCCTACA
AGTTGCTACACTATCTTTGCAAGGGAACATGTTTACTGGTCCTATTCCATCAGTTATTGG
ACTTATGCAGGCTCTCGCTGTACTGGATCTGAGTTACAACCAATTGTCTGGTCCTATTCC
ATCGATACTAGGCAATTTAACATACACTGAGAAGCTGTATATGCAAGGCAATAAGTTAAC
AGGTCCAATACCACCTGAGCTTGGAAATATGTCAACCCTTCATTACTTAGAACTTAACGA
TAATCAACTTAGCGGGTTCATTCCTCCAGAGTTCGGAAAGCTAACAGGGTTATTTGACTT
AAACCTTGCAAACAACAACTTTGAAGGTCCAATCCCTGATAACATAAGCTCATGTGTGAA
TCTCAATAGCTTCAATGCTTATGGCAACAGATTAAATGGGACCATTCCTCCTTCATTGCA
TAAACTTGAGAGCATGACTTATTTGAATTTGTCATCAAATTTTCTAAGTGGTTCTATTCC
TATTGAGCTATCGAGAATCAACAATTTGGACACCTTGGATTTATCCTGTAACATGATTAC
TGGCCCAATTCCATCAACCATTGGGAGTTTGGAGCATCTATTAAGACTTAACTTGAGCAA
CAATGGTCTAGTAGGATTCATTCCTGCAGAAATTGGCAACTTGAGGAGTATCATGGAGAT
TGATATGTCCAACAATCATCTTGGCGGTTTGATTCCTCAAGAACTCGGAATGCTGCAAAA
TCTGATGTTGTTAAATCTCAAAAACAACAACATAACTGGGGATGTCTCTTCACTGATGAA
CTGCTTCAGCCTCAATATCTTAAATGTATCCTATAATAATTTGGCTGGTGTTGTACCTAC
TGATAACAACTTCTCACGGTTTTCGCCTGACAGCTTTTTGGGTAATCCAGGACTTTGTGG
ATATTGGCTTGGTTCTTCGTGCCGTTCATCTGGCCATCAACAGAAACCACTAATCTCAAA
GGCTGCAATACTTGGAATTGCCGTGGGTGGGCTTGTTATCCTCCTGATGATCTTAGTAGC
GGTCTGCAGGCCTCATAGTCCACCTGTTTTCAAAGATGTCTCTGTTAGCAAACCAGTGAG
CAATGTTCCCCCCAAGCTGGTTATCCTTCATATGAACCTTTCCCTTCTTGTATACGAGGA
TATAATGACGATGACTGAAAACCTGAGTGAGAAGTACATCATTGGGTACGGAGCATCCAG
CACGGTTTATAAATGTGTTTCGAAGAACCGCAAACCAGTGGCAGTAAAAAAGCTATATGC
CCACTATCCACAGAGCTTCAAGGAATTTGAAACTGAGCTTGAGACTGTTGGTAGCATCAA
ACACCGGAATCTAGTCAGTCTTCAAGGATATTCCCTATCTCCTGTTGGAAATCTTCTCTT
CTACGATTACATGGAAAATGGAAGCCTCTGGGATGTTTTGCATGAAGGTCCAACTAAGAA
GAAAAAACTTGATTGGGAAACTCGTCTACGAATTGCTCTAGGTGCGGCCCAAGGCCTTGC
TTATCTTCATCATGACTGTAGCCCACGGATAAtacacagggatgtgaaatcaaaaaatat
actccttgataaagattatgaggcacatcttacagactttggcattgctaagagtttgtg
tgtttcaaaaactcacacgtccacctatgtcatgggaactattggctatatCGATCCTGA
GTATGCTCGCACCTCCCGTCTCAATGAAAAGTCTGATGTCTACAGCTATGGCATTGTTCT
GCTTGAGCTGCTGACCGGAAAAAAGCCAGTGGACAACGAGTGCAATCTCCATCACTTGAT
CTTGTCAAAGACGGCTAACAATGCTGTCATGGAGACAGTCGACCCGGACATTGCAGACAC
TTGCAAGGATCTTGGTGAGGTCAAGAAGGTGTTCCAGCTGGCGCTCCTTTGCACCAAGAG
ACAACCATCGGATCGGCCGACAATGCACGAGGTTGTGCGCGTCCTGGACTGCCTAGTTCG
TCCCGACCCGCCACCGAAGTCCGCACAGCAGCTGGCCATGCCGCAGCGGCCTGCTGTCCC
GAGCTACATCAACGAGTATGTCAGCTTAAGAGGCACCAGCGTGCTCTCCTGCGCCAACTC
GTCGTGTACTTCCGATGCTGAGCTGTTTCTCAAGTTTGGCGAGGTCATTTCTCAGAACAC
AGAGTAGAATAGTCTGCAGAAATCGTCATCCGATCTTGGGATTCAGGCAAGCAGCTGGTG
AAGCTAATCAAGGTAGTGAAGTGAACTCACGTTTTGTGACTTTGTCCACATGTTGGGTGC
CCAGAAAATTAACAAGAGAATTCTCAAGGGTTGTGGCTGGTGTTCTTTACTGTAAAAAAA
ATGCGTCCTACTTCTTTCTTCTTCCTTTTTTTTTATCTCGTTTTTGTCTAACTTAGGAGG
TGTCCATGAATCTAGTACTAAATCTCAAGACAGCTTCTTCTGTTCTGTAACATTTCTGGG
ATTGGAATGCTGGAACTGGTATTACTAATAGTCTCTCGGTTTGGACAAATTCGCAGGGTG
GTGTTTCAGTTTC

CDS

2937 bp

>Os06t0203800-01 Receptor-like kinase, Heat tolerance
ATGACGCCGGCGCCGGCGGCCGCCTCCTACCGCGCTCTCGTCGCGCTCCTGCTCGTCGCC
GTCGCCGTTGCCGATGATGGGTCGACGCTGCTGGAGATCAAGAAGTCCTTCCGCAATGTG
GACAACGTACTGTACGATTGGGCCGGCGGCGACTACTGCTCGTGGCGCGGCGTCCTCTGC
GACAACGTCACCTTCGCCGTCGCCGCGCTCAACCTATCCGGGCTCAACCTCGGAGGCGAG
ATCTCTCCGGCCGTCGGCAGGTTGAAGGGCATCGTCTCGATTGACTTGAAGTCGAATGGG
CTGTCTGGGCAGATCCCTGATGAGATTGGCGATTGTTCATCACTAAAAACTCTGGATTTG
TCTTTCAATAGCTTGGATGGGGACATTCCGTTCTCAGTATCGAAGCTGAAGCACATTGAG
AGCTTGATATTGAAGAACAACCAACTGATCGGAGTGATCCCATCAACGCTCTCACAGCTC
CCAAATTTGAAGATTTTGGACTTGGCACAGAACAAACTGAGTGGAGAGATACCAAGACTG
ATATATTGGAACGAGGTTCTTCAATACTTGGGATTACGCGGTAATAATTTAGAAGGCAGC
ATCTCCCCAGATATATGCCAGTTGACTGGGCTTTGGTACTTTGACGTAAAGAACAACAGC
TTGACTGGGCCGATACCAGAAACCATTGGGAACTGTACAAGTTTTCAGGTCTTGGATTTG
TCTTACAATAAACTTTCTGGATCAATTCCTTTCAACATTGGTTTCCTACAAGTTGCTACA
CTATCTTTGCAAGGGAACATGTTTACTGGTCCTATTCCATCAGTTATTGGACTTATGCAG
GCTCTCGCTGTACTGGATCTGAGTTACAACCAATTGTCTGGTCCTATTCCATCGATACTA
GGCAATTTAACATACACTGAGAAGCTGTATATGCAAGGCAATAAGTTAACAGGTCCAATA
CCACCTGAGCTTGGAAATATGTCAACCCTTCATTACTTAGAACTTAACGATAATCAACTT
AGCGGGTTCATTCCTCCAGAGTTCGGAAAGCTAACAGGGTTATTTGACTTAAACCTTGCA
AACAACAACTTTGAAGGTCCAATCCCTGATAACATAAGCTCATGTGTGAATCTCAATAGC
TTCAATGCTTATGGCAACAGATTAAATGGGACCATTCCTCCTTCATTGCATAAACTTGAG
AGCATGACTTATTTGAATTTGTCATCAAATTTTCTAAGTGGTTCTATTCCTATTGAGCTA
TCGAGAATCAACAATTTGGACACCTTGGATTTATCCTGTAACATGATTACTGGCCCAATT
CCATCAACCATTGGGAGTTTGGAGCATCTATTAAGACTTAACTTGAGCAACAATGGTCTA
GTAGGATTCATTCCTGCAGAAATTGGCAACTTGAGGAGTATCATGGAGATTGATATGTCC
AACAATCATCTTGGCGGTTTGATTCCTCAAGAACTCGGAATGCTGCAAAATCTGATGTTG
TTAAATCTCAAAAACAACAACATAACTGGGGATGTCTCTTCACTGATGAACTGCTTCAGC
CTCAATATCTTAAATGTATCCTATAATAATTTGGCTGGTGTTGTACCTACTGATAACAAC
TTCTCACGGTTTTCGCCTGACAGCTTTTTGGGTAATCCAGGACTTTGTGGATATTGGCTT
GGTTCTTCGTGCCGTTCATCTGGCCATCAACAGAAACCACTAATCTCAAAGGCTGCAATA
CTTGGAATTGCCGTGGGTGGGCTTGTTATCCTCCTGATGATCTTAGTAGCGGTCTGCAGG
CCTCATAGTCCACCTGTTTTCAAAGATGTCTCTGTTAGCAAACCAGTGAGCAATGTTCCC
CCCAAGCTGGTTATCCTTCATATGAACCTTTCCCTTCTTGTATACGAGGATATAATGACG
ATGACTGAAAACCTGAGTGAGAAGTACATCATTGGGTACGGAGCATCCAGCACGGTTTAT
AAATGTGTTTCGAAGAACCGCAAACCAGTGGCAGTAAAAAAGCTATATGCCCACTATCCA
CAGAGCTTCAAGGAATTTGAAACTGAGCTTGAGACTGTTGGTAGCATCAAACACCGGAAT
CTAGTCAGTCTTCAAGGATATTCCCTATCTCCTGTTGGAAATCTTCTCTTCTACGATTAC
ATGGAAAATGGAAGCCTCTGGGATGTTTTGCATGAAGGTCCAACTAAGAAGAAAAAACTT
GATTGGGAAACTCGTCTACGAATTGCTCTAGGTGCGGCCCAAGGCCTTGCTTATCTTCAT
CATGACTGTAGCCCACGGATAAtacacagggatgtgaaatcaaaaaatatactccttgat
aaagattatgaggcacatcttacagactttggcattgctaagagtttgtgtgtttcaaaa
actcacacgtccacctatgtcatgggaactattggctatatCGATCCTGAGTATGCTCGC
ACCTCCCGTCTCAATGAAAAGTCTGATGTCTACAGCTATGGCATTGTTCTGCTTGAGCTG
CTGACCGGAAAAAAGCCAGTGGACAACGAGTGCAATCTCCATCACTTGATCTTGTCAAAG
ACGGCTAACAATGCTGTCATGGAGACAGTCGACCCGGACATTGCAGACACTTGCAAGGAT
CTTGGTGAGGTCAAGAAGGTGTTCCAGCTGGCGCTCCTTTGCACCAAGAGACAACCATCG
GATCGGCCGACAATGCACGAGGTTGTGCGCGTCCTGGACTGCCTAGTTCGTCCCGACCCG
CCACCGAAGTCCGCACAGCAGCTGGCCATGCCGCAGCGGCCTGCTGTCCCGAGCTACATC
AACGAGTATGTCAGCTTAAGAGGCACCAGCGTGCTCTCCTGCGCCAACTCGTCGTGTACT
TCCGATGCTGAGCTGTTTCTCAAGTTTGGCGAGGTCATTTCTCAGAACACAGAGTAG

Protein

979 aa

>Os06t0203800-01 Receptor-like kinase, Heat tolerance
MTPAPAAASYRALVALLLVAVAVADDGSTLLEIKKSFRNVDNVLYDWAGGDYCSWRGVLC
DNVTFAVAALNLSGLNLGGEISPAVGRLKGIVSIDLKSNGLSGQIPDEIGDCSSLKTLDL
SFNSLDGDIPFSVSKLKHIESLILKNNQLIGVIPSTLSQLPNLKILDLAQNKLSGEIPRL
IYWNEVLQYLGLRGNNLEGSISPDICQLTGLWYFDVKNNSLTGPIPETIGNCTSFQVLDL
SYNKLSGSIPFNIGFLQVATLSLQGNMFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSIL
GNLTYTEKLYMQGNKLTGPIPPELGNMSTLHYLELNDNQLSGFIPPEFGKLTGLFDLNLA
NNNFEGPIPDNISSCVNLNSFNAYGNRLNGTIPPSLHKLESMTYLNLSSNFLSGSIPIEL
SRINNLDTLDLSCNMITGPIPSTIGSLEHLLRLNLSNNGLVGFIPAEIGNLRSIMEIDMS
NNHLGGLIPQELGMLQNLMLLNLKNNNITGDVSSLMNCFSLNILNVSYNNLAGVVPTDNN
FSRFSPDSFLGNPGLCGYWLGSSCRSSGHQQKPLISKAAILGIAVGGLVILLMILVAVCR
PHSPPVFKDVSVSKPVSNVPPKLVILHMNLSLLVYEDIMTMTENLSEKYIIGYGASSTVY
KCVSKNRKPVAVKKLYAHYPQSFKEFETELETVGSIKHRNLVSLQGYSLSPVGNLLFYDY
MENGSLWDVLHEGPTKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLD
KDYEAHLTDFGIAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLEL
LTGKKPVDNECNLHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPS
DRPTMHEVVRVLDCLVRPDPPPKSAQQLAMPQRPAVPSYINEYVSLRGTSVLSCANSSCT
SDAELFLKFGEVISQNTE*

5'UTR

chr06:5251474..5251843 (- strand) : 370 bp

CDS

chr06:5251395..5251473 (- strand) : 79 bp

chr06:5250432..5250561 (- strand) : 130 bp

chr06:5250273..5250344 (- strand) : 72 bp

chr06:5250102..5250173 (- strand) : 72 bp

chr06:5249945..5250016 (- strand) : 72 bp

chr06:5249762..5249833 (- strand) : 72 bp

chr06:5249611..5249682 (- strand) : 72 bp

chr06:5249255..5249326 (- strand) : 72 bp

chr06:5249101..5249172 (- strand) : 72 bp

chr06:5248947..5249015 (- strand) : 69 bp

chr06:5248782..5248853 (- strand) : 72 bp

chr06:5248610..5248681 (- strand) : 72 bp

chr06:5248386..5248457 (- strand) : 72 bp

chr06:5248233..5248304 (- strand) : 72 bp

chr06:5248070..5248141 (- strand) : 72 bp

chr06:5247918..5247989 (- strand) : 72 bp

chr06:5247695..5247766 (- strand) : 72 bp

chr06:5247543..5247614 (- strand) : 72 bp

chr06:5247391..5247462 (- strand) : 72 bp

chr06:5247242..5247313 (- strand) : 72 bp

chr06:5247084..5247152 (- strand) : 69 bp

chr06:5246928..5246999 (- strand) : 72 bp

chr06:5246768..5246841 (- strand) : 74 bp

chr06:5246552..5246680 (- strand) : 129 bp

chr06:5246028..5246375 (- strand) : 348 bp

chr06:5245470..5245843 (- strand) : 374 bp

chr06:5244605..5244973 (- strand) : 369 bp

3'UTR

chr06:5244239..5244604 (- strand) : 366 bp

FASTA

>Os06t0203800-01 class=Sequence position=chr06:5244239..5251843 (- strand)
GATGTGACAT CTCAGTGTCC ATCGGCCATC GCCTCCTTTT CTCTCTCCTC TCCTCTCACC ATCTTCTCCT ACAGCAAATC
ACTCTTCTCT CTCTCTAAAA AACTTCACAA GCCTACTAGC CTACTACTAG GCACGTAGCT AGCCCCTGCC ACTCTATCGC
CCAGCACAAG CCATACAGCT ACCCGCTGTC ACTGCGCCAG CGGCCGCAGC TGCGCAAAGA GGAGCGCGAG AACCCAAGAA
ACCAACCAAG AGCTGCGTCC CATAAAGGCG CGCTGCTTCA ATCCATCCAT CTTCTGATCT TCCATATACT TCGCTTCCTG
TAAATGTCAT CGCCGCCCCG GCGGTGCCTC GCAGCGGAGC AGCAGTGGCC ATGACGCCGG CGCCGGCGGC CGCCTCCTAC
CGCGCTCTCG TCGCGCTCCT GCTCGTCGCC GTCGCCGTTG CCGATGATGG TGGGTGGATG GCTGGCTAGC TAGCTGGCTG
TTGGTTTTCG GTTTTGGTTG GTTTCTTGCT GGGGGGAGTG TGTGGTTTTG TGTACTGGGG AGCAGAGAGA TTCAGGGGGG
AGTTGGTTTG ATGGGATTAG TATTTTATTA GTGTTGCAAG TACTCTTCCT TTTTGGAGGC ATGGTGATTC TCTTGTGGGT
GATAGTCCTA CTACTATTTT TTATTGTCCT AAGATCTCCC TAAGAAGAGT CTAATACTTT AACTAATCCT TGTGAGTGAG
TTGTGACAAG TGCCACTTCC ATCTCTTCTC TTCCTTCTTG TACTAGAACA CAGTTGCTGG CATTTTGTTT ATGGTGGTGG
TAGCCACTAG GTAATCCACC AATATTTCAT AATGTGATTC TTTTTTTTTT CACTTTCTGT TTTGTTCTAC AAGGGACTCC
GTTCTGCTTT GGTATTCTGT TACTTATCAA GAAGTCGTCT GGCCATTTTT GAATCTTTGT GCTCATTGTT CAAGGAAGGA
GCTTTATTTC TTCTTTTGTA TGTTACTACC AATCTGATGA GCCGAATGCT GCTGCCCGCG TCAGGAATCT TTAGGCTTTG
TAGCAACCTT TTACTTTACT ATTGTGCTGA TTTTTGTGCT TTCCAATCTG ATGTTCTTGA ACTCTTTTTT TTTTTGTCTT
GAAGGCTAAG AAACATAAAT CTTTATTTAT TAGTACTACT ACGTAAATAG ATTTTTTCCG GGGCGAACAA ATCTGTGCAG
ATTGTGCTGT TCTAGAATCC ATTTGCTGTT GCAGGCTTGC AGTTTGTGAT CTGTGTTCTA ATGTGGCTGT ATTTGCATTC
AGGGTCGACG CTGCTGGAGA TCAAGAAGTC CTTCCGCAAT GTGGACAACG TACTGTACGA TTGGGCCGGC GGCGACTACT
GCTCGTGGCG CGGCGTCCTC TGCGACAACG TCACCTTCGC CGTCGCCGCG CTGTAAGAAG AACACCACCG AGTTCGCTAC
TTTTCTTGCT GACAAGTCCA CTGGTTCGTC ACTGATCATG CCTGTTGATT GCAAAGCAGC AACCTATCCG GGCTCAACCT
CGGAGGCGAG ATCTCTCCGG CCGTCGGCAG GTTGAAGGGC ATCGTCTCGA TGTATGGAAG ACGTGGTGGT GTACTTTGTT
GTTGTTTGGA AATGTGGCTT GCTGGTGCTT GGACTCGCAG TAACTTGTGA GCTTGGGTTT GTACCTGCAG TGACTTGAAG
TCGAATGGGC TGTCTGGGCA GATCCCTGAT GAGATTGGCG ATTGTTCATC ACTAAAAACT CTGTGAGTTG TGTGGAGTGT
GGACGGCATT ATCGATTTCT TCTTAACTTA CGGAGAGAAT GTGGGTTGAT ACATGTGTTT GGTTCAGGGA TTTGTCTTTC
AATAGCTTGG ATGGGGACAT TCCGTTCTCA GTATCGAAGC TGAAGCACAT TGAGAGCTTG TATGGCCTAT TCTTGCTGGA
ATTCATTTAT TATAAGCAGT GTTGTATGGA CATGCCGATC GTGTTCTGTG AAATAGTTTT ATTCATGTGC CGGTGTTTGT
GGTTTTCTAG GATATTGAAG AACAACCAAC TGATCGGAGT GATCCCATCA ACGCTCTCAC AGCTCCCAAA TTTGAAGATT
TTGTAAGTTG CGCGAAACTT CTTATTTTTG TGGTGTTTAA TTACCGTGCT CCCAGTTTTC TAATTGTTGT GTGCCCTGCA
GGGACTTGGC ACAGAACAAA CTGAGTGGAG AGATACCAAG ACTGATATAT TGGAACGAGG TTCTTCAATA CTTGTAAGTC
ATCCTTATTT TGCGCTGGAA GTTTGAAGAT TGTGCAGTAG TTCTAGTATA TCAGTATTTT ATTGTATTTT AGTTATGTAC
CTACTTGAAT GCGATTTCTT TTTTTTTCTT TTTTTTGAAA ATCATTTGAA TGTATTTAAG AGCATGTCAA AAGTTTGTTA
AGCTGGTAAA AATCTATATT GACTTTATGT GAATTCACTA GCATTTTACG CAAGTTGCGT TATGTAAAAT ACTCATATTT
TTTTTATGAA TTGTGGCTGA ATTAATATTA TCCTCAGGGG ATTACGCGGT AATAATTTAG AAGGCAGCAT CTCCCCAGAT
ATATGCCAGT TGACTGGGCT TTGGTACTTG TGAGTATATG CATACTATGT TTTCGGCAAA ATTTGCCTCG AGTCCACCGT
ATTGTACTTA TGTTTCAATC ATTTGGACCA GTGACGTAAA GAACAACAGC TTGACTGGGC CGATACCAGA AACCATTGGG
AACTGTACAA GTTTTCAGGT CTTGTACGTA TTTGCAGCTT ACCCCTCTTA ATTACAACTT TTCTGCTTCT GTGTTTGTGA
GGTTTTCCTA ACATTTCTTT CATGTTAGGG ATTTGTCTTA CAATAAACTT TCTGGATCAA TTCCTTTCAA CATTGGTTTC
CTACAAGTTG CTACACTGTA TGTGGTGATT ATCTTGACAA AAAAAAACTC AATTAAATGT TTAATACAGT TTTTGCTGAT
CTGCATGATT ATTCACATTG TTTGAATTAG ATCTTTGCAA GGGAACATGT TTACTGGTCC TATTCCATCA GTTATTGGAC
TTATGCAGGC TCTCGCTGTA CTGTAAGTAC AATGATGAAC TGAATATTCA TCATACAATT GGTTATTGAT AAATGAAGCT
TTCAAGATAT TTTAATTCAT CAATATAACT TTACTCTTCC AGGGATCTGA GTTACAACCA ATTGTCTGGT CCTATTCCAT
CGATACTAGG CAATTTAACA TACACTGAGA AGCTGTAAGT TTTCTTTTCT CCTAAATCGT TAGGTTGTGA ATATTTTCCC
TGATAGATTT TCTACTGCCA GTTCATAGTT AAAAAACAAA AGCCTTAGAA GGTTCTGCTT AGGAATATTT CTTGTGTAAA
TTAATATGTT ATATTTGTTC CAATAGGTAT ATGCAAGGCA ATAAGTTAAC AGGTCCAATA CCACCTGAGC TTGGAAATAT
GTCAACCCTT CATTACTTGT AAGTGCACGT TTTATTTTAT TCCCATAGCA TATTCTGATT TGTTGCGACC TGATTTATGT
CATTGTTGAC TAATTTCAGA GAACTTAACG ATAATCAACT TAGCGGGTTC ATTCCTCCAG AGTTCGGAAA GCTAACAGGG
TTATTTGACT TGTAAGCTCT TTTTTCAAAC TCTTCAAAAT TTGTTATGTT TTCTATAATT TATTAGTAAA ACAAGCGGCT
TATCTTACTC TTTGCTTCAC AGAAACCTTG CAAACAACAA CTTTGAAGGT CCAATCCCTG ATAACATAAG CTCATGTGTG
AATCTCAATA GCTTGTAAGC ATGATTTAAT TATAATTGTT ATGGTGGAAC TTACAATTTC AGATGCATGT ATCTAATGTG
GATTTTCTTT ACAGCAATGC TTATGGCAAC AGATTAAATG GGACCATTCC TCCTTCATTG CATAAACTTG AGAGCATGAC
TTATTTGTAA GTTGTAACAA TTTTAATTTC TTAAATTGTG TTGTTACATT ATTTTTCCTT TTGAACTTCT ATACTTGTTT
AATTTTTGTA TTTCACATAG AAAAACCTTG TTTCCCATGT TTGATTAGTA CCATATGTTC ATCTGTTCTT TTCTTAGGAA
TTTGTCATCA AATTTTCTAA GTGGTTCTAT TCCTATTGAG CTATCGAGAA TCAACAATTT GGACACCTTG TAAGTCCTGT
TAGCTCCATC TATGAATTCG AAAATATCTG TTCTATCCTA TTGTGTGTGT GATGAGGTAC CTGTATCAGG GATTTATCCT
GTAACATGAT TACTGGCCCA ATTCCATCAA CCATTGGGAG TTTGGAGCAT CTATTAAGAC TGTAGGTTTT GTTGTCCCCA
TCTTGTATGT ATCTATTATA GTGTCTTACA GTGTTTGATG TTATTGAACT TGTTTGTTCA GTAACTTGAG CAACAATGGT
CTAGTAGGAT TCATTCCTGC AGAAATTGGC AACTTGAGGA GTATCATGGA GATGTAAGTA TTTGCTTAGG TGTGAATTTT
TTAACCATCT AGTCCCATAG GTACTATACC CCATATTTGT GGTTTTTCAG TGATATGTCC AACAATCATC TTGGCGGTTT
GATTCCTCAA GAACTCGGAA TGCTGCAAAA TCTGATGTTG TTGTAAGTAG TACCTTTCAT GTCAGCCTTC TTTTTAAACC
CATAAGGACA TTGAATCTGT AGCCTGAGAG ACATCTGTCT ATCATTCTCA GAAATCTCAA AAACAACAAC ATAACTGGGG
ATGTCTCTTC ACTGATGAAC TGCTTCAGCC TCAATATCTT GTAAGTTGAA TAACCAGAAA ATTTTTGAAG CATATGCTCC
AGTATATGTT TTTTGCTCAC ATTATCTATC TGTTTTATGA TCAGAAATGT ATCCTATAAT AATTTGGCTG GTGTTGTACC
TACTGATAAC AACTTCTCAC GGTTTTCGCC TGACAGGTAG TGTGCTCCAT CATTTCCATC ACTATCATGT TCATTTACTC
AGCCTTGGAA ATAGCAGTTT AACAATGTGA TACTTTTCTT AGCTTTTTGG GTAATCCAGG ACTTTGTGGA TATTGGCTTG
GTTCTTCGTG CCGTTCATCT GGCCATCAAC AGAAACGTAA CAAATATTCC ATTCATATCT TACATAATTT TTTCATACCT
AATAGACAAA GTCAACTTTT CGTTACCTAC ATTTTATTTG CAGCACTAAT CTCAAAGGCT GCAATACTTG GAATTGCCGT
GGGTGGGCTT GTTATCCTCC TGATGATCTT AGTAGCGGTC TGCAGGCCTC ATAGTCCACC TGTTTTCAAA GATGTCTCTG
TTAGCAAACC AGGTAATGCA TCTGCAAGGA GTTTTGCTCA ACAAATCAAC TCATTTCTCT CCTGCCAAGT TCAATATTAG
GATACTATCT TGTCCAGCAA TTATTGTATT TAGTCAATTG TTTGTTTTTA CCTGATAACT GGGTTAATGG TAGAGCAACA
CTAAAGCGCT GTATATTTGC TGTCACAGTG AGCAATGTTC CCCCCAAGCT GGTTATCCTT CATATGAACC TTTCCCTTCT
TGTATACGAG GATATAATGA CGATGACTGA AAACCTGAGT GAGAAGTACA TCATTGGGTA CGGAGCATCC AGCACGGTTT
ATAAATGTGT TTCGAAGAAC CGCAAACCAG TGGCAGTAAA AAAGCTATAT GCCCACTATC CACAGAGCTT CAAGGAATTT
GAAACTGAGC TTGAGACTGT TGGTAGCATC AAACACCGGA ATCTAGTCAG TCTTCAAGGA TATTCCCTAT CTCCTGTTGG
AAATCTTCTC TTCTACGATT ACATGGAAAA TGGAAGCCTC TGGGATGTTT TGCATGGTAA GTGCCGACTG CCAACTCATT
GCACAGTTTG ATTGTCATTG CAATTTGCAC AGAAGCACCA ACATGCCATT CTCAAAAGCA TGATATTTGA CACATTGATA
TTTGCTTCTG TTGATTGCAA TACCAAATTG TTACATGACA TCTTGTTACC ATGTTAAAAT CTTTTTTTTC ATTATTCTAG
AAGGTCCAAC TAAGAAGAAA AAACTTGATT GGGAAACTCG TCTACGAATT GCTCTAGGTG CGGCCCAAGG CCTTGCTTAT
CTTCATCATG ACTGTAGCCC ACGGATAAta cacagggatg tgaaatcaaa aaatatactc cttgataaag attatgaggc
acatcttaca gactttggca ttgctaagag tttgtgtgtt tcaaaaactc acacgtccac ctatgtcatg ggaactattg
gctatatCGA TCCTGAGTAT GCTCGCACCT CCCGTCTCAA TGAAAAGTCT GATGTCTACA GCTATGGCAT TGTTCTGCTT
GAGCTGCTGA CCGGAAAAAA GCCAGTGGAC AACGAGTGCA ATCTCCATCA CTTGGTAACT ATGATTCATG CTCTTGTGAT
TCTTCTGTTA ATCTGTCATT TTCTTCAGCT TATTTTACTT TGGATTCTGG TAGCCCTCAA TAATTGCTGA ATGATGCCCA
TTAGGCTTGT GTTCCTACAT GGGGACCAAC AACATGAAAC CTATCCTGTG AGTAGATCTA TTTGCACTGT TTACGTGTGG
TGGATTGATC CATCGCATAT GGCTGTTGAA AGCTCCATTA TCAATTGCAG TGTTTAAGTC CCCTAAAGCC TGCCACTTTT
GTCCCCTGTC ATCAATTATG TGGATTGAAA GCTACAATTT AGTGTCATAA AAATTCCTCT TGCAGCCATT TACATTTTTT
ACGCCTTCAC TTGGCATTTA ACCGACCTCC GACTTGGAGA GTCACCCTAA TTTCTCATTG ATTTTACATG CTTATATGGC
TTTTCATTTA TCGGTTTTCC TTGCTAATGT ACAGACTGTT ACAATTCTTG GTCTACTGTT GCAAATGCAG ATCTTGTCAA
AGACGGCTAA CAATGCTGTC ATGGAGACAG TCGACCCGGA CATTGCAGAC ACTTGCAAGG ATCTTGGTGA GGTCAAGAAG
GTGTTCCAGC TGGCGCTCCT TTGCACCAAG AGACAACCAT CGGATCGGCC GACAATGCAC GAGGTTGTGC GCGTCCTGGA
CTGCCTAGTT CGTCCCGACC CGCCACCGAA GTCCGCACAG CAGCTGGCCA TGCCGCAGCG GCCTGCTGTC CCGAGCTACA
TCAACGAGTA TGTCAGCTTA AGAGGCACCA GCGTGCTCTC CTGCGCCAAC TCGTCGTGTA CTTCCGATGC TGAGCTGTTT
CTCAAGTTTG GCGAGGTCAT TTCTCAGAAC ACAGAGTAGA ATAGTCTGCA GAAATCGTCA TCCGATCTTG GGATTCAGGC
AAGCAGCTGG TGAAGCTAAT CAAGGTAGTG AAGTGAACTC ACGTTTTGTG ACTTTGTCCA CATGTTGGGT GCCCAGAAAA
TTAACAAGAG AATTCTCAAG GGTTGTGGCT GGTGTTCTTT ACTGTAAAAA AAATGCGTCC TACTTCTTTC TTCTTCCTTT
TTTTTTATCT CGTTTTTGTC TAACTTAGGA GGTGTCCATG AATCTAGTAC TAAATCTCAA GACAGCTTCT TCTGTTCTGT
AACATTTCTG GGATTGGAAT GCTGGAACTG GTATTACTAA TAGTCTCTCG GTTTGGACAA ATTCGCAGGG TGGTGTTTCA
GTTTC

Locus: Os06g0203800

Loading...

Locus: Os06g0203800

Loading...