Os06t0205000-01

Locus

Os06g0205000

Description

Similar to Ubiquitin-like protein ATG12.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG12

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 12

Oryzabase Gene Symbol Synonym(s)

OsATG12, Atg12

Oryzabase Gene Name Synonym(s)

autophagy 12, AUTOPHAGY RELATED12

Transcript Evidence

AK243073 (DDBJ, Best hit)

Protein Evidence

Q69NP0 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: autophagic vacuole assembly (GO:0000045)

Cellular Component: cytoplasm (GO:0005737)

Functional domain (InterPro)

Autophagy-related protein 12 (IPR007242)

Full-length cDNA

J100018F14 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0205000-01)

Others

Oryzabase (9656)

Transcript

828 bp

>Os06t0205000-01 Similar to Ubiquitin-like protein ATG12.
GTCTTCCTCGTCGTCTTGCAAGTCTGCTTCCACCTCTCTTCCATCTCCGAATTCCTTCCC
CCCGCCGCTCGCCGGAGCGGGGAACGTGGTGTTTCCGCCGGCGGTTTACCCCAATCGGGA
GTCCTCCCCCAATCCGGGTGGACTTCGAGTTTCGAGTCGGAATCTCGCAAGAACAGTCCG
TCCCGGACTCCTCCCCCCCATCGGATCGGCCAGAAAAATCCATCGGAGTCAGTTCCTTCC
CCCCGTGCGAATCTGACGGGGGCGCAACTCGTCGCGGATTTCTCCCTGTTCCCCCCCCAC
CTCCGGCGATGGCCGCGGTCGCCGCCGAGCAGAAGAAAGTCGTGGTGCACTTCCGGTCGA
CGGGCAACGCGCCGCAGCTGAAGCAGTCCAAGTTCAAGATTGGTGGAAACGAGAAATTTC
TGAAGATCATTGACTTTCTTCGCCGACAAATTCACCAGGATACAGTGTTTCTCTATGTGA
ACAGTGCATTTTCACCAAATCCAGATGAGTTGATAATCGACCTATACAATAACTTTGGAA
TCGACGGGCAACTGGTGGTTAACTATGCATCATCGATGGCATGGGGCTGAAAGGCTGTAC
CTGCTGGAGAGAGGAAACTTCAATCAACATGGAAAAACCTGTGTACAAAATTTACTTGCC
GAAACACTCATCATGTAAATTGCTGAGAATTTAACTTCAAAGCGAAGCTCTTTCGAATTA
TTATTCGGTACACGTTGATGTCAGTAGCAGCAGCTGCAATTTTCACGGGGCTTTCAGCCC
CACTGTAAAACTGAGACATCCTTCATTAAACGCCCCAGTGCTTCAGAC

CDS

282 bp

>Os06t0205000-01 Similar to Ubiquitin-like protein ATG12.
ATGGCCGCGGTCGCCGCCGAGCAGAAGAAAGTCGTGGTGCACTTCCGGTCGACGGGCAAC
GCGCCGCAGCTGAAGCAGTCCAAGTTCAAGATTGGTGGAAACGAGAAATTTCTGAAGATC
ATTGACTTTCTTCGCCGACAAATTCACCAGGATACAGTGTTTCTCTATGTGAACAGTGCA
TTTTCACCAAATCCAGATGAGTTGATAATCGACCTATACAATAACTTTGGAATCGACGGG
CAACTGGTGGTTAACTATGCATCATCGATGGCATGGGGCTGA

Protein

93 aa

>Os06t0205000-01 Similar to Ubiquitin-like protein ATG12.
MAAVAAEQKKVVVHFRSTGNAPQLKQSKFKIGGNEKFLKIIDFLRRQIHQDTVFLYVNSA
FSPNPDELIIDLYNNFGIDGQLVVNYASSMAWG*

5'UTR

chr06:5308684..5308991 (+ strand) : 308 bp

CDS

chr06:5308992..5309022 (+ strand) : 31 bp

chr06:5309101..5309159 (+ strand) : 59 bp

chr06:5310042..5310110 (+ strand) : 69 bp

chr06:5310192..5310254 (+ strand) : 63 bp

chr06:5310543..5310602 (+ strand) : 60 bp

3'UTR

chr06:5310603..5310840 (+ strand) : 238 bp

FASTA

>Os06t0205000-01 class=Sequence position=chr06:5308684..5310840 (+ strand)
GTCTTCCTCG TCGTCTTGCA AGTCTGCTTC CACCTCTCTT CCATCTCCGA ATTCCTTCCC CCCGCCGCTC GCCGGAGCGG
GGAACGTGGT GTTTCCGCCG GCGGTTTACC CCAATCGGGA GTCCTCCCCC AATCCGGGTG GACTTCGAGT TTCGAGTCGG
AATCTCGCAA GAACAGTCCG TCCCGGACTC CTCCCCCCCA TCGGATCGGC CAGAAAAATC CATCGGAGTC AGTTCCTTCC
CCCCGTGCGA ATCTGACGGG GGCGCAACTC GTCGCGGATT TCTCCCTGTT CCCCCCCCAC CTCCGGCGAT GGCCGCGGTC
GCCGCCGAGC AGAAGAAAGG TTCGTCCCTT CCTCTTTCCT CGTCCTTCAG CGTTCGTTTC TTCTGCTTAA CCCCATCTCG
TGGTTGCGCA ATCGCAGTCG TGGTGCACTT CCGGTCGACG GGCAACGCGC CGCAGCTGAA GCAGTCCAAG TTCAAGGTGC
GGGGCTTCTC TTGTCCTCTT CTTGTTGAAT CTTTGCTCCC TGCTTGCACG ATTCCCACAT GTTGTATCGT CTGATGCCGA
TTATTGTTAC TGTAATTTCG CAATGATCTT GCGTTAAAGC GAATGTGTAG CGCGCTAGTT CAGCCTAGGC CGATTAAACC
AGCAGATTAA AAATGTAGTT AATCGAGCCA CGAAATATCA GTTTGCTTTT GTGTAGAGAT GGAAGAACTC GTATTTGGGG
GGACTATGTT GTAATACCCT AGAAAAATGT TGTTAGGTGA GGCATCCTGC AGCAACGTGG CCTTCATTGT ATCCATCAGG
AGACAGGATT TTGAAAAAGG GGGGGGGGGG GAAGGTGATT GATTGGCTCG TTGAATTTTT GATGATTTTT ATAATGTCTA
TTTCATAGTA TTAATAGTAG TATGCACAAG AAATAAACGT GCTGATTCAG TCAAAGATTT TTTTAGAAAA TAGTATACCT
GGAGTAACTT CACGATGTCG CCTCATGATA TATTGGATCT AGCGATGGCA ATGGAGCCCC GTTGCCACCC CGGATTTGAT
CAGGTTATTT TCGGTGGTGT CATATGGTGT TTCATCTTTT TTTTTTTAGT CTAGTATGGA AGATATGTAC ATGGCTTGTA
GAGGGTGGCA CCATGTAGTT TTGATGCCCT AGTCAAGTAT CAGATGCATT AGTATTTTGT GGTTCTACGG ACATAATTTT
CTGTTCAATT TGTATGAGAC TATGAGTTCC TTGTTTAATG AGCGAGTAAA TAAATTGCCC TGGAACTCAT AGTGAAATGA
TGGTAACTTG TTATGGTTCA TCCGTTCATG CAATTGGAAG CTGGAATTAC ACATAGGCTT TTGCTTTTGC ATTTTCAGAT
TGGTGGAAAC GAGAAATTTC TGAAGATCAT TGACTTTCTT CGCCGACAAA TTCACCAGGA TACAGTGGTA CAAATATAGC
TTGTAGGTTC ATCTGAGTTG AATCAACATG CTTAGAAATT TGTTGATTTT TTTTTGTTTT ACCTGCAGTT TCTCTATGTG
AACAGTGCAT TTTCACCAAA TCCAGATGAG TTGATAATCG ACCTATACAA TGTAAGCTTT GATGTCCGTG CTATCCGTTC
TTACATATCA ATGTACTGCC AAATAACCTT CAGCAGAGTG CATTATCATT TTTTTAAGAG AACTTCAAAA CCATTTTGAC
ATCAAGGCTT GAAAGTTAAT TGTAGGTGTA GCATACTGAC TTGGTTTCTA AACTAATTAC TGATGAATGA TACTACAGTA
TGAGTAATTA CATAACCTAG TGATATTATT CTGGTATCGA TGTCACATTT GGTGAATGAT TAAAGGACTA ACACTAAACA
TTTATGTTTT GCATCAAAGA ACTTTGGAAT CGACGGGCAA CTGGTGGTTA ACTATGCATC ATCGATGGCA TGGGGCTGAA
AGGCTGTACC TGCTGGAGAG AGGAAACTTC AATCAACATG GAAAAACCTG TGTACAAAAT TTACTTGCCG AAACACTCAT
CATGTAAATT GCTGAGAATT TAACTTCAAA GCGAAGCTCT TTCGAATTAT TATTCGGTAC ACGTTGATGT CAGTAGCAGC
AGCTGCAATT TTCACGGGGC TTTCAGCCCC ACTGTAAAAC TGAGACATCC TTCATTAAAC GCCCCAGTGC TTCAGAC

Locus: Os06g0205000

Loading...

Locus: Os06g0205000

Loading...