Os06t0209700-01

Locus

Os06g0209700

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK063529 (DDBJ, Best hit)

Protein Evidence

B9FS46 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-117-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0209700-01)

Transcript

1452 bp

>Os06t0209700-01 Conserved hypothetical protein.
AATATTTTTTTTTTTCAAAACAATCCTTCAGCGGCAATCGCCGACTAACTGTCCCGGTGG
TCGCCGGCGGACGCGTCCGATCTCCGATGGCCTCCGCCGCCGCCGCCGCCGCATCCCCCG
GCGACGCGCGGCCCCGGTGCACTGCACTCCAAAACCTACCTCTTACTCTGCTAGTCAGTG
ACCTCGCTCTCCTCCACTGCGTTCCCCTCCTCCCCCCTCCGCCGCTGCGTTCTCCCCTCA
CGAGGTCACCTGACGGCCGGAGACGGCCGCGGTGGTGTCCCCCCTCCCTGCGCCGGAGTC
GACGACGACGCCGCCTCTGCGGCTGCCTTTGCCACCTGGAAAATGTTTCCAAGATAGAAT
GTGCATGCATCTTCAGATTCATCACGATGGATAAGAATGTTTGGTGAGGTGCACAAGTCA
GATTATTGGTTGTCTAGTAAAGCCCTATAGGAAACAAGTTCGTCTGGCAACCTGCAAGAA
TCCCAATTCAAAACAAACTCCCATTAATCAATCAACATCGCTCCATCAATTATTGTAGTG
TGATGATGTTAAAACAGGAGCATATACAGTTAACATTGGTGGCAAAAACATGGTACGATT
CTTCTTTGTCAGCACCTATCAGCTGCACATAGCATGCGTCCAGAACAGATGGCAAAGAAT
CGAAGCCGCGAGAGAGGCACCAACTTATTCATAGGATAACTTAGAATGTTCCTGTTATAT
ACTTTTTTCCTATGGTTTTGTGGTTGCCTACTCCTCATCCAATCTTGCAAGTTGCTGTTA
AACATAATGTTTACTCCAAGACCAGAGGCCTCTGGACTCTGGAGGGTCAACAAATTTGAT
ATAGATCCACGCAGAAGTTTCTGAATTCTGATTTTGACTATGCCTCTTTGTGTACAGGGA
GAGGAGGGAGGATTCAGAGATGGATATTATCAATATACTCCATGGATGCAAATCCTAACA
AGAGCGCACCATGCATCGGCGACGCATCAGCATGCACTAACTTTAATTGCCAAGGCCCTA
GTTGATTGCTGCCACCATCACTTGTTGGAATTATTTTTGTTAGGTGAATTCACAGGTCGT
TGCCTTGCTTGCTTGCTCCTCACATTGTGAAAAGAACCACCCCTCCAATGCAAAAATGAA
CTGTTCATCTCTTTATATAGATGCATACTTAAAGCAAAAATGAGTGCTTCCGTGTGAGAG
AAAAAAAATCAATTAATTAAGACATACTGATTGCTTAGCTCTGGCAGTTGTGAATTTGTG
ACGCATCTCTCCAAAAGTAGTTATGTGCGTCAGACAAGTGTGTTGTCCGTTTCTTGATTG
TGAGGGAGCAAAACTTTCATGAAGGCCAGAGCATTACAGCAAATATTTTGTGCTTAAATA
CAATTTGTTTATCTGAATTTTCATTGAGAACCCCTCTCCTTTAGGGGAATGAACCAATGA
ATTATTTGTGCC

CDS

321 bp

>Os06t0209700-01 Conserved hypothetical protein.
ATGGCCTCCGCCGCCGCCGCCGCCGCATCCCCCGGCGACGCGCGGCCCCGGTGCACTGCA
CTCCAAAACCTACCTCTTACTCTGCTAGTCAGTGACCTCGCTCTCCTCCACTGCGTTCCC
CTCCTCCCCCCTCCGCCGCTGCGTTCTCCCCTCACGAGGTCACCTGACGGCCGGAGACGG
CCGCGGTGGTGTCCCCCCTCCCTGCGCCGGAGTCGACGACGACGCCGCCTCTGCGGCTGC
CTTTGCCACCTGGAAAATGTTTCCAAGATAGAATGTGCATGCATCTTCAGATTCATCACG
ATGGATAAGAATGTTTGGTGA

Protein

107 aa

>Os06t0209700-01 Conserved hypothetical protein.
MASAAAAAASPGDARPRCTALQNLPLTLLVSDLALLHCVPLLPPPPLRSPLTRSPDGRRR
PRWCPPSLRRSRRRRRLCGCLCHLENVSKIECACIFRFITMDKNVW*

5'UTR

chr06:5601748..5601833 (+ strand) : 86 bp

CDS

chr06:5601834..5602092 (+ strand) : 259 bp

chr06:5603876..5603937 (+ strand) : 62 bp

3'UTR

chr06:5603938..5604982 (+ strand) : 1045 bp

FASTA

>Os06t0209700-01 class=Sequence position=chr06:5601748..5604982 (+ strand)
AATATTTTTT TTTTTCAAAA CAATCCTTCA GCGGCAATCG CCGACTAACT GTCCCGGTGG TCGCCGGCGG ACGCGTCCGA
TCTCCGATGG CCTCCGCCGC CGCCGCCGCC GCATCCCCCG GCGACGCGCG GCCCCGGTGC ACTGCACTCC AAAACCTACC
TCTTACTCTG CTAGTCAGTG ACCTCGCTCT CCTCCACTGC GTTCCCCTCC TCCCCCCTCC GCCGCTGCGT TCTCCCCTCA
CGAGGTCACC TGACGGCCGG AGACGGCCGC GGTGGTGTCC CCCCTCCCTG CGCCGGAGTC GACGACGACG CCGCCTCTGC
GGCTGCCTTT GCCACCTGGA AAATGGTAAT GGTACCGTGC TTCCACTTGC GTCCAGATCT AAGATTTGCT TTAGGTTTGG
AGGTGCAGTG TTACTGTGTT AGTGCTGATC GTTCTGTCGG GAGACCATTA GTAGGAAGAA CAGTAACATT TCTAGTCCCC
ATTACTTTGA ACCCTAACAT TTTGTTAGAG ATCATGGTGC AAATTGGCAT TCTAGTATTT ATTTGTTGAT CAATGTGACT
AACAAATTGA AGTCTTCTGA GAATCTATTA CTCTGGATCA TAATGTGATA CGCAAAACTA ATATGGAGTT CGACTCTCCT
TGTTTGCTGG CAACATCGAA ATTTGAAATT AATAAACAAG AAATTGTGCT TGGCTTGAAG TCTCAgtttt atttatgtca
ttattggtag tttttgctat ttggaattaa caaataccaa cctgtagttt tgtcttaatt ttAGTATTTT GTTAATTAGA
TAATTATAAA ATTCGAAATT AATAGTTACT AAATTTTAGC TGACGGTGAA CTGTTCTTTT AATCCAAACC ATTATAATTC
GGATCTTCCT AGATAAATGG CTAGATCTAT TCAATCCTTT TGATTAATAG ATGGTGGAAG TGCAAAAGGT GATACCACCT
GGTCCATGTC CAAGCCACTA GCTGGCCTGG CAGTTAGCAC TTAGCAGTAC ATGTTGTCAT GCGTAGGATC TCCACATATA
CAAGATCTCC AGCGTACTAC ATCTTCCAAG CATAATATCA GCCTGATTAT ATCCATAAGC ACAGTGGCCA AGCATGGTTA
TCGATCGACT AACTCAAATA TATATCGGCG TATGTACTAT CCCTACATAT ATGTGGCCAG AAAAAACCCA AACCCCACCA
ATAATGTACC CGTATATACA GATCAACTTG TTGCTACAAG CCTACAACTG ACCAAAGTTT TCTTGTTGTG ATTAAGACAA
ATGTATGTTA GTGGCCTACA TGACTACACC CTATATATAC TCCAATGTGC AATGCTGAAT ATCATGACGA TTGTGAACAA
CACGCATTGC TTGCCATCAC TGTACCTTGC ACTAACACCA CTAAAGAGTC TGGACTTTGT GGTACTTGTG AGTTGTCAGT
CACTTCTACA CACTCTACAC ACTGACAATT CTTCGTCCGT ATATACCCAT AAGACCCTTT TTTTTTAAAA AAAAAGAAAA
ACTCATATAG GCTTTTTTGG TGAAAATGGT GATGATCTAG CTAGGTTGGT TGGCTGATTC GTCTGGCCAA TGGTTTTCAT
GGTCAGTGTG AACTGTCAAG TGTGACTAGG GGAAGGCTGT CATGATATGA TTGGCATCTA ATTATTTACT GATCTTATTA
TGTAGTTCAG AGTCTTCAAA GGCATCCCCG TTATCGGTTT TTCTCACTAA CCATTTCTGG AAATATGTAT GTAGTCGGAA
GGTTGAGCCA CACATCTAGT GGCAACGCCC AAGACAGAAT TTGTGTTGTT AGCTGATAGG CACAATAGTT TTGTCAGGAC
ACTTAACAAT GCGTTGCTCT CTGCATGTTC CATGCCCTGC TACAGAGGTT GTTCAGAGTA TTTTTCATAT GTAGTACGTT
GATTCATATT CCGCATTTCA GCTATTGATT TACCTGATAA ATATGATAGA CAGCTTTGTG AATTATCAGA CTTCAAATTT
TGAATATCAT CCTGCCCTCT TTCCAACCAA AAGAAGTTTG TCAGCAGCAT AGCATTCAAC AAGCATCTTG GCTTGAAAAG
ACTATACTGC TAACATCGAT CTGATCTGAA CTTCTTTCAC TTTTGTAGTT TCCAAGATAG AATGTGCATG CATCTTCAGA
TTCATCACGA TGGATAAGAA TGTTTGGTGA GGTGCACAAG TCAGATTATT GGTTGTCTAG TAAAGCCCTA TAGGAAACAA
GTTCGTCTGG CAACCTGCAA GAATCCCAAT TCAAAACAAA CTCCCATTAA TCAATCAACA TCGCTCCATC AATTATTGTA
GTGTGATGAT GTTAAAACAG GAGCATATAC AGTTAACATT GGTGGCAAAA ACATGGTACG ATTCTTCTTT GTCAGCACCT
ATCAGCTGCA CATAGCATGC GTCCAGAACA GATGGCAAAG AATCGAAGCC GCGAGAGAGG CACCAACTTA TTCATAGGAT
AACTTAGAAT GTTCCTGTTA TATACTTTTT TCCTATGGTT TTGTGGTTGC CTACTCCTCA TCCAATCTTG CAAGTTGCTG
TTAAACATAA TGTTTACTCC AAGACCAGAG GCCTCTGGAC TCTGGAGGGT CAACAAATTT GATATAGATC CACGCAGAAG
TTTCTGAATT CTGATTTTGA CTATGCCTCT TTGTGTACAG GGAGAGGAGG GAGGATTCAG AGATGGATAT TATCAATATA
CTCCATGGAT GCAAATCCTA ACAAGAGCGC ACCATGCATC GGCGACGCAT CAGCATGCAC TAACTTTAAT TGCCAAGGCC
CTAGTTGATT GCTGCCACCA TCACTTGTTG GAATTATTTT TGTTAGGTGA ATTCACAGGT CGTTGCCTTG CTTGCTTGCT
CCTCACATTG TGAAAAGAAC CACCCCTCCA ATGCAAAAAT GAACTGTTCA TCTCTTTATA TAGATGCATA CTTAAAGCAA
AAATGAGTGC TTCCGTGTGA GAGAAAAAAA ATCAATTAAT TAAGACATAC TGATTGCTTA GCTCTGGCAG TTGTGAATTT
GTGACGCATC TCTCCAAAAG TAGTTATGTG CGTCAGACAA GTGTGTTGTC CGTTTCTTGA TTGTGAGGGA GCAAAACTTT
CATGAAGGCC AGAGCATTAC AGCAAATATT TTGTGCTTAA ATACAATTTG TTTATCTGAA TTTTCATTGA GAACCCCTCT
CCTTTAGGGG AATGAACCAA TGAATTATTT GTGCC

Locus: Os06g0209700

Loading...

Locus: Os06g0209700

Loading...