Os06t0213700-01

Locus

Os06g0213700

Description

Cyclin-dependent kinase inhibitor 2, KIP-related protein, Seed development

RAP-DB Gene Symbol Synonym(s)

KRP2

RAP-DB Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 2, KIP-related protein 2

CGSNL Gene Symbol

KRP2

CGSNL Gene Name

KIP-RELATED PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsKRP2, OsiICK2, Orysa;KRP2, OrysaICK2, Orysa;ICK2

Oryzabase Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 2, KIP-related protein 2, inhibitor of cyclin-dependent kinase 2

Transcript Evidence

DQ229363

Protein Evidence

Q283L3

Literature

PMID: 17012406

Note

Manual Curation

January 16, 2020

Gene Ontology (GO)

Biological Process: cell cycle arrest (GO:0007050)

Molecular Function: cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Cyclin-dependent kinase inhibitor (IPR003175)

Expression Databases

TENOR (Os06t0213700-00)

Others

Oryzabase (12355)

KEGG (Os06t0213700-00)

Transcript

750 bp

>Os06t0213700-01 Cyclin-dependent kinase inhibitor 2, KIP-related protein, Seed development
ATGGGGAAGAAGAAGAAGCGCGACGGCGCGGCGGCGAGGAGGCAGGCGCGGGTGGTGGTC
GGCGGCGTCCGTACGCGGGCCGCCGTCACGGCGAGGAGGGTGGTGGCGAGCGCGGAGGAG
GGTTGTGGTTTGGTGGGCCGTGGCGGTGGCGGTGGCAGTGGCGGAGACGATGGCGAGGGC
GGATGCTATCTGCGTCTGCGGAGCAGGAGGCTGCCCTTCGTGGCGGCCGCGGTGGTGTCG
TCGCGGAGGGAGGAGGCGCTCGGTGATTCGGTGGCGGAGGCGGCTTCGTCGTCGTCGTCG
CGGGCGGTGGAATTGTTGGGCTGTTCTGGTGAGGAGGAGGCTATGGCCGAGAAGGTTTGC
ACGCAGGCAGGCGAGGATCACGACGAGGAGAGCTCCGTCGGCGACTCCGGCTGCGGCCGC
GAGAGGAGCGCGACGACGCCGTCGAGCCGCCGGCCGCCGGGAGACGCGGACTCGAGCGAC
GCGGAGTCAAACCAGGAGGCCAAGCAGCAAATGTGCCGCCGGAGTTCGACGACCTCAGCA
GCTGCATTTCACGCGGGAGCGACGACGAGGAGCTTCAGGATGATGGCACCGCCGGCGGCG
GCGGCAGAGATCGAGGAGTTCCTCGCCGCTGCGGAGAGGTCCGAGGCCGAGCGCTTCGCC
GCCAAGTACAACTTCGACGTGGTGCGCGGCGTGCCGCTCGACGCCGGCGGCGCCGGGCGG
TTCGAATGGACCGCGGTGGGCAGCGGCTGA

CDS

750 bp

>Os06t0213700-01 Cyclin-dependent kinase inhibitor 2, KIP-related protein, Seed development
ATGGGGAAGAAGAAGAAGCGCGACGGCGCGGCGGCGAGGAGGCAGGCGCGGGTGGTGGTC
GGCGGCGTCCGTACGCGGGCCGCCGTCACGGCGAGGAGGGTGGTGGCGAGCGCGGAGGAG
GGTTGTGGTTTGGTGGGCCGTGGCGGTGGCGGTGGCAGTGGCGGAGACGATGGCGAGGGC
GGATGCTATCTGCGTCTGCGGAGCAGGAGGCTGCCCTTCGTGGCGGCCGCGGTGGTGTCG
TCGCGGAGGGAGGAGGCGCTCGGTGATTCGGTGGCGGAGGCGGCTTCGTCGTCGTCGTCG
CGGGCGGTGGAATTGTTGGGCTGTTCTGGTGAGGAGGAGGCTATGGCCGAGAAGGTTTGC
ACGCAGGCAGGCGAGGATCACGACGAGGAGAGCTCCGTCGGCGACTCCGGCTGCGGCCGC
GAGAGGAGCGCGACGACGCCGTCGAGCCGCCGGCCGCCGGGAGACGCGGACTCGAGCGAC
GCGGAGTCAAACCAGGAGGCCAAGCAGCAAATGTGCCGCCGGAGTTCGACGACCTCAGCA
GCTGCATTTCACGCGGGAGCGACGACGAGGAGCTTCAGGATGATGGCACCGCCGGCGGCG
GCGGCAGAGATCGAGGAGTTCCTCGCCGCTGCGGAGAGGTCCGAGGCCGAGCGCTTCGCC
GCCAAGTACAACTTCGACGTGGTGCGCGGCGTGCCGCTCGACGCCGGCGGCGCCGGGCGG
TTCGAATGGACCGCGGTGGGCAGCGGCTGA

Protein

250 aa

>Os06t0213700-01 Cyclin-dependent kinase inhibitor 2, KIP-related protein, Seed development
MGKKKKRDGAAARRQARVVVGGVRTRAAVTARRVVASAEEGCGLVGRGGGGGSGGDDGEG
GCYLRLRSRRLPFVAAAVVSSRREEALGDSVAEAASSSSSRAVELLGCSGEEEAMAEKVC
TQAGEDHDEESSVGDSGCGRERSATTPSSRRPPGDADSSDAESNQEAKQQMCRRSSTTSA
AAFHAGATTRSFRMMAPPAAAAEIEEFLAAAERSEAERFAAKYNFDVVRGVPLDAGGAGR
FEWTAVGSG*

CDS

chr06:5795457..5795810 (- strand) : 354 bp

chr06:5795286..5795356 (- strand) : 71 bp

chr06:5794952..5795191 (- strand) : 240 bp

chr06:5794738..5794822 (- strand) : 85 bp

FASTA

>Os06t0213700-01 class=Sequence position=chr06:5794738..5795810 (- strand)
ATGGGGAAGA AGAAGAAGCG CGACGGCGCG GCGGCGAGGA GGCAGGCGCG GGTGGTGGTC GGCGGCGTCC GTACGCGGGC
CGCCGTCACG GCGAGGAGGG TGGTGGCGAG CGCGGAGGAG GGTTGTGGTT TGGTGGGCCG TGGCGGTGGC GGTGGCAGTG
GCGGAGACGA TGGCGAGGGC GGATGCTATC TGCGTCTGCG GAGCAGGAGG CTGCCCTTCG TGGCGGCCGC GGTGGTGTCG
TCGCGGAGGG AGGAGGCGCT CGGTGATTCG GTGGCGGAGG CGGCTTCGTC GTCGTCGTCG CGGGCGGTGG AATTGTTGGG
CTGTTCTGGT GAGGAGGAGG CTATGGCCGA GAAGGTGATT GATGAGCCCT AGAATTCCTC CGCGGCTCGA GTGCTCGATC
GCCCGCTTCC ATCTCTTGCT GAATGATGCG GCTTGGGATG TGGTGGTTTT GCAGGTTTGC ACGCAGGCAG GCGAGGATCA
CGACGAGGAG AGCTCCGTCG GCGACTCCGG CTGCGGCCGC GAGAGGTGAT CGAGCTCCTC TCCACGCGTT CTTGCTTGTC
CTTGACATGA TTAATTACAA CCGCCGTTCT CTCAATTGAA TTATCGCAAT TCAATCCAGG AGCGCGACGA CGCCGTCGAG
CCGCCGGCCG CCGGGAGACG CGGACTCGAG CGACGCGGAG TCAAACCAGG AGGCCAAGCA GCAAATGTGC CGCCGGAGTT
CGACGACCTC AGCAGCTGCA TTTCACGCGG GAGCGACGAC GAGGAGCTTC AGGATGATGG CACCGCCGGC GGCGGCGGCA
GAGATCGAGG AGTTCCTCGC CGCTGCGGAG AGGTCCGAGG CCGAGCGCTT CGCCGCCAAG TGAGTGCTGC ATCACATATT
GTCGTCCGTG CGTCGTGTCG TACATATCGT CGTCGTCGTC AAAATCGGCC TCGATCGCGA CATGCATGGC CGCATGGGAG
CTGATTAACG TGCGCTCCTC CTCCTCAGGT ACAACTTCGA CGTGGTGCGC GGCGTGCCGC TCGACGCCGG CGGCGCCGGG
CGGTTCGAAT GGACCGCGGT GGGCAGCGGC TGA

Locus: Os06g0213700

Loading...

Locus: Os06g0213700

Loading...