Os06t0213700-02

Locus

Os06g0213700

Description

Cyclin-dependent kinase inhibitor 2, KIP-related protein, Grain filling, Seed germination, Seed morphogenesis

RAP-DB Gene Symbol Synonym(s)

KRP2

RAP-DB Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 2, KIP-related protein 2

CGSNL Gene Symbol

KRP2

CGSNL Gene Name

KIP-RELATED PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsKRP2, OsiICK2, Orysa;KRP2, OrysaICK2, Orysa;ICK2

Oryzabase Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 2, KIP-related protein 2, inhibitor of cyclin-dependent kinase 2

Transcript Evidence

Inferred from literature

Protein Evidence

A0A0E0PV08 (Oryza rufipogon)

Literature

PMID: 31905829

Note

Manual Curation

January 16, 2020

Gene Ontology (GO)

Biological Process: cell cycle arrest (GO:0007050)

Biological Process: cellulose biosynthetic process (GO:0030244)

Molecular Function: cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Cellular Component: nucleus (GO:0005634)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Cyclin-dependent kinase inhibitor (IPR003175)

Cellulose synthase (IPR005150)

Others

Oryzabase (12355)

Transcript

1233 bp

>Os06t0213700-02 Cyclin-dependent kinase inhibitor 2, KIP-related protein, Grain filling, Seed germination, Seed morphogenesis
ATGGGGAAGAAGAAGAAGCGCGACGGCGCGGCGGCGAGGAGGCAGGCGCGGGTGGTGGTC
GGCGGCGTCCGTACGCGGGCCGCCGTCACGGCGAGGAGGGTGGTGGCGAGCGCGGAGGAG
GGTTGTGGTTTGGTGGGCCGTGGCGGTGGCGGTGGCAGTGGCGGAGACGATGGCGAGGGC
GGATGCTATCTGCGTCTGCGGAGCAGGAGGCTGCCCTTCGTGGCGGCCGCGGTGGTGTCG
TCGCGGAGGGAGGAGGCGCTCGGTGATTCGGTGGCGGAGGCGGCTTCGTCGTCGTCGTCG
CGGGCGGTGGAATTGTTGGGCTGTTCTGGTGAGGAGGAGGCTATGGCCGAGAAGGTTTGC
ACGCAGGCAGGCGAGGATCACGACGAGGAGAGCTCCGTCGGCGACTCCGGCTGCGGCCGC
GAGAGGAGCGCGACGACGCCGTCGAGCCGCCGGCCGCCGGGAGACGCGGACTCGAGCGAC
GCGGAGTCAAACCAGGAGGCCAAGCAGCAAATGTGCCGCCGGAGTTCGACGACCTCAGCA
GCTGCATTTCACGCGGGAGCGACGACGAGGAGCTTCAGGATGATGGCACCGCCGGCGGCG
GCGGCAGAGATCGAGGAGTTCCTCGCCGCTGCGGAGAGGTCCGAGGCCGAGCGCTTCGCC
GCCAAGTACAACTTCGACGTGGTGCGCGGCGTGCCGCTCGACGCCGGCGGCGCCGGGCGG
TTCGAATGGACCGCGCGTTTTGATTCAGATTCAAACTGGGCTGCCTTGGGCCAACGTGTT
ACGAGGTGCGACGCGGAGAGTAGTCGTGGCCCCATCAAGCGCGTCCCGGACCTCGCCGTC
CTCGCCGACCGGCACTCCGGCGAGCTCCCCGGCGTCGACGTCTTCGTCACCACCGTCGAC
CCTGTCGACGAGCCGATACTCTACACCGTGAACACCTTCCTCTCCATCCTCACCACCGAC
TACCCGGTGGACAGCTGTAAACCGAGGCTTCGATTGGCAGCGAGTGCTGAGAATCCGGTT
GATTTCAGTGGTGTTGACGTGCGGCTCCCCATGCTAGTGTACATCTCGCGCGAGAAGCCG
TGCGCCGGGAAGCGCCAGTGCTCGAACCCCGCCGCCGCGTCGCCCGACCTCGCCGGCGCC
TCCACCTGCGACAGCACGCACACGAGGGACGTCACGTGGCTGCTCGCCAGCGAGTCGCCG
AAGAACAGCGCACGGCGCCTCCGCGTTCACTGA

CDS

1233 bp

>Os06t0213700-02 Cyclin-dependent kinase inhibitor 2, KIP-related protein, Grain filling, Seed germination, Seed morphogenesis
ATGGGGAAGAAGAAGAAGCGCGACGGCGCGGCGGCGAGGAGGCAGGCGCGGGTGGTGGTC
GGCGGCGTCCGTACGCGGGCCGCCGTCACGGCGAGGAGGGTGGTGGCGAGCGCGGAGGAG
GGTTGTGGTTTGGTGGGCCGTGGCGGTGGCGGTGGCAGTGGCGGAGACGATGGCGAGGGC
GGATGCTATCTGCGTCTGCGGAGCAGGAGGCTGCCCTTCGTGGCGGCCGCGGTGGTGTCG
TCGCGGAGGGAGGAGGCGCTCGGTGATTCGGTGGCGGAGGCGGCTTCGTCGTCGTCGTCG
CGGGCGGTGGAATTGTTGGGCTGTTCTGGTGAGGAGGAGGCTATGGCCGAGAAGGTTTGC
ACGCAGGCAGGCGAGGATCACGACGAGGAGAGCTCCGTCGGCGACTCCGGCTGCGGCCGC
GAGAGGAGCGCGACGACGCCGTCGAGCCGCCGGCCGCCGGGAGACGCGGACTCGAGCGAC
GCGGAGTCAAACCAGGAGGCCAAGCAGCAAATGTGCCGCCGGAGTTCGACGACCTCAGCA
GCTGCATTTCACGCGGGAGCGACGACGAGGAGCTTCAGGATGATGGCACCGCCGGCGGCG
GCGGCAGAGATCGAGGAGTTCCTCGCCGCTGCGGAGAGGTCCGAGGCCGAGCGCTTCGCC
GCCAAGTACAACTTCGACGTGGTGCGCGGCGTGCCGCTCGACGCCGGCGGCGCCGGGCGG
TTCGAATGGACCGCGCGTTTTGATTCAGATTCAAACTGGGCTGCCTTGGGCCAACGTGTT
ACGAGGTGCGACGCGGAGAGTAGTCGTGGCCCCATCAAGCGCGTCCCGGACCTCGCCGTC
CTCGCCGACCGGCACTCCGGCGAGCTCCCCGGCGTCGACGTCTTCGTCACCACCGTCGAC
CCTGTCGACGAGCCGATACTCTACACCGTGAACACCTTCCTCTCCATCCTCACCACCGAC
TACCCGGTGGACAGCTGTAAACCGAGGCTTCGATTGGCAGCGAGTGCTGAGAATCCGGTT
GATTTCAGTGGTGTTGACGTGCGGCTCCCCATGCTAGTGTACATCTCGCGCGAGAAGCCG
TGCGCCGGGAAGCGCCAGTGCTCGAACCCCGCCGCCGCGTCGCCCGACCTCGCCGGCGCC
TCCACCTGCGACAGCACGCACACGAGGGACGTCACGTGGCTGCTCGCCAGCGAGTCGCCG
AAGAACAGCGCACGGCGCCTCCGCGTTCACTGA

Protein

411 aa

>Os06t0213700-02 Cyclin-dependent kinase inhibitor 2, KIP-related protein, Grain filling, Seed germination, Seed morphogenesis
MGKKKKRDGAAARRQARVVVGGVRTRAAVTARRVVASAEEGCGLVGRGGGGGSGGDDGEG
GCYLRLRSRRLPFVAAAVVSSRREEALGDSVAEAASSSSSRAVELLGCSGEEEAMAEKVC
TQAGEDHDEESSVGDSGCGRERSATTPSSRRPPGDADSSDAESNQEAKQQMCRRSSTTSA
AAFHAGATTRSFRMMAPPAAAAEIEEFLAAAERSEAERFAAKYNFDVVRGVPLDAGGAGR
FEWTARFDSDSNWAALGQRVTRCDAESSRGPIKRVPDLAVLADRHSGELPGVDVFVTTVD
PVDEPILYTVNTFLSILTTDYPVDSCKPRLRLAASAENPVDFSGVDVRLPMLVYISREKP
CAGKRQCSNPAAASPDLAGASTCDSTHTRDVTWLLASESPKNSARRLRVH*

CDS

chr06:5795457..5795810 (- strand) : 354 bp

chr06:5795286..5795356 (- strand) : 71 bp

chr06:5794952..5795191 (- strand) : 240 bp

chr06:5794753..5794822 (- strand) : 70 bp

chr06:5794366..5794416 (- strand) : 51 bp

chr06:5791872..5792059 (- strand) : 188 bp

chr06:5791466..5791724 (- strand) : 259 bp

FASTA

>Os06t0213700-02 class=Sequence position=chr06:5791466..5795810 (- strand)
ATGGGGAAGA AGAAGAAGCG CGACGGCGCG GCGGCGAGGA GGCAGGCGCG GGTGGTGGTC GGCGGCGTCC GTACGCGGGC
CGCCGTCACG GCGAGGAGGG TGGTGGCGAG CGCGGAGGAG GGTTGTGGTT TGGTGGGCCG TGGCGGTGGC GGTGGCAGTG
GCGGAGACGA TGGCGAGGGC GGATGCTATC TGCGTCTGCG GAGCAGGAGG CTGCCCTTCG TGGCGGCCGC GGTGGTGTCG
TCGCGGAGGG AGGAGGCGCT CGGTGATTCG GTGGCGGAGG CGGCTTCGTC GTCGTCGTCG CGGGCGGTGG AATTGTTGGG
CTGTTCTGGT GAGGAGGAGG CTATGGCCGA GAAGGTGATT GATGAGCCCT AGAATTCCTC CGCGGCTCGA GTGCTCGATC
GCCCGCTTCC ATCTCTTGCT GAATGATGCG GCTTGGGATG TGGTGGTTTT GCAGGTTTGC ACGCAGGCAG GCGAGGATCA
CGACGAGGAG AGCTCCGTCG GCGACTCCGG CTGCGGCCGC GAGAGGTGAT CGAGCTCCTC TCCACGCGTT CTTGCTTGTC
CTTGACATGA TTAATTACAA CCGCCGTTCT CTCAATTGAA TTATCGCAAT TCAATCCAGG AGCGCGACGA CGCCGTCGAG
CCGCCGGCCG CCGGGAGACG CGGACTCGAG CGACGCGGAG TCAAACCAGG AGGCCAAGCA GCAAATGTGC CGCCGGAGTT
CGACGACCTC AGCAGCTGCA TTTCACGCGG GAGCGACGAC GAGGAGCTTC AGGATGATGG CACCGCCGGC GGCGGCGGCA
GAGATCGAGG AGTTCCTCGC CGCTGCGGAG AGGTCCGAGG CCGAGCGCTT CGCCGCCAAG TGAGTGCTGC ATCACATATT
GTCGTCCGTG CGTCGTGTCG TACATATCGT CGTCGTCGTC AAAATCGGCC TCGATCGCGA CATGCATGGC CGCATGGGAG
CTGATTAACG TGCGCTCCTC CTCCTCAGGT ACAACTTCGA CGTGGTGCGC GGCGTGCCGC TCGACGCCGG CGGCGCCGGG
CGGTTCGAAT GGACCGCGGT GGGCAGCGGC TGAGGCGAAG CATATGCATG CGGAATTGCA AACCGGCAGT GGCCAAGGCA
TGGTAAAAGA GATGCTCTCA GTTAATGGAA AAATCCGAAA AATGTAAAGT GAAAATAAGG ATCGAAAGGA TAAATAGAAG
AAAAAAATAA CAGAGGAGTT CCATTAATTT ACCAGCAGCC TGGACAGTTA GCTCGATTGA TCTGGTCGAT TATTTGCTCT
AAAAAAAATC TTTATTTCTT TTCGTAGTTC AAGTTCATGA TCATGCTCAT GCATGTCCCT AGTTAGTAGT CACTACAGTT
TCTTCACTCT TCTGGCTATT TCGTGCGACT TCAGCGTTTT GATTCAGATT CAAACTGGGC TGCCTTGGGC CAACGTGTTA
CGAGGGTAAG GCCGGAAGAA CTTAGgcggt gttcttttgt atgggttggg aacccctccc ctccgcataa aaaacggagt
gatagattaa cacatgatta attaaataCC CGCCCGACCA TCTCCTTTTC CTCTCCAGAG GACCAAAGCA GAAAAAATAT
AATTCATACT ATTATCTCCA TCCTTTAATA TACAGCGAAa gtggattcta atattttaag aggtgtccca tcttgtatct
ttttctttca aattcgatac aaatagttgt gagaaattct gaaaaaatta acaatgtaaa atatagtgat atctatcggt
ccaccaaaaa tcaagtttaa attcgatcta cccatcaaag aaaaaaaaga taaatttaga tgtgaacaat atgctactat
tcatatgctg atttttttat atctcgacat gtgagttgag tttggatcta agattttgtg gagttgtata gatatgttgt
atgagcgttg ctattttttt tcttaaccgt ttaaatggtt tttaagcaaa tgataaacat tttctcaaga gatcaaaata
gtttcccATA TATAACCAAA GTCATACATT AATTAAAGAT AAAGTGAATA TGTATGCTAC TACCTCCATC CCAAGAAGAT
TTCACTTGTT GCCATCATTT TTATTTTTAC AAAAAGTCTT TTTGATTAGG TAGTAGTACT ATTTAACCAG GACAACAAGC
TAGATTCCGG CCGTCCCTAG AAGAGTACTG ATTCACATAA GCAACTTGAA TGATGATGCT ACTACTGATT CACATCGACA
ACTTGAATTA ACCAGGATGA CAAAAGTGTA TTGTTCCTGG ATTTTCTAAA CACGGCGAAG TTGCCACATT TGCCACGAAT
TTTAGAAAGT CAGCAAAGGA AGCAACATTT AGGGCCCTTT TATTCGCAGG ATAGAAAAAA CACAGGAATT GAAGTAGTAG
GTTtctcaaa tcctacagga atcagcaaac acaggaaaaa taataggagt catttaatag tgctatagga aaaacaaagg
aaaattcaca aagaggtgac acctcttgct atttttccta tgaaatgtga agcataggaa tacaatccta tgaaaagttt
cctttctttc ctttgaatca aagggacatg taagaaaaaa ttcataggat ttgaatctta taaaaatcat ttgccaatcc
tataaatcaa agggccctta caTCAGAAAA GCAGTCATCA GATAGGGGCA CGTAACGTTA AATGTGTGGA GACATTTCTT
TCTTTCTTTT GTGTAGATAT GAATGTCTTA TCTGATGATA GTCAAATAAA TTAGTTTCCG TTTTGAAAAG GACCGGAATT
GTCACAGTCC TGGACTGCTC TCTATCACAT CCTTGATTGT TCTTTTATGA GTTTTTTTTT TTTTggaaaa agtacgaatt
acccccctga actatcgcgg tcgatcgaat taccccctta aacccgaaaa ccagacatcg tttaccctga atttttaata
ccggacaaat tacccccctc aacccaaacc aaagcggttt cgtcctacgt ggcgtacgcg tggcagtcca gttagcattt
tatttataaa aaatatagga cccacctgtc atactccttt tccactcttc ctctctctct tctctctctA CCACTCTCTC
TCTCATTGTG AACGCGGAGG CGTCGTGCGC TGTTCTTCGG CGACTCGCTG GCGAGCAGCC ACGTGACGTC CGTCACGTCC
CTCGTGTGCG TGCTGTCGCA GGTGGAGGCG CCGGCGAGGT CGGGCGACGC GGCGGCGGGG TTCGAGCACT GGCGCCGGCG
CACGGCTTCG CCGTTGCGTA CTTCTGGTTC TGGACGTCGT TCCCCCTCCT ACTCGCCGCA CCGCGGGACG CGCGGAGGCG
GCGGACGAGG GGGCCACCGC CCGCGCGTCG CCGTTCCCCC TCCTACTCGC TGCCTCTGCC GCAGCGAACT CCTCGGCCTG
CGCCCGGTAG AActtcgcct ccgtcgccgc catctctggc gccgccccgt cctcgctctc gttgaccggc cgcgtcgcgG
TGCACTCCCC GCCGTCGAAC CACCCGCCGT TCTCGTAGTG CGTCGGCGCC ACCGTGCGTA GGATCGCCGT GCCGTTGAAC
CCGTCCAGCC TCACCAGCGC CCCGAGCACG GAACGCCGCC CGCTACGCGT GCTCCGGCTG CTTGAGAATG GTTGTGCCGT
TGTTGTCGCC GCAGTCGTGG CAGCCGACGA CGCGGCCGTG CTGGTAGTAC ACGGCCGGGC GCGCGAACCA GTGCGACGCG
GAGAGTAGTC GTGGCCCCAT CAAGCGCGTC CCGGACCTCG CCGTCCTCGC CGACCGGCAC TCCGGCGAGC TCCCCGGCGT
CGACGTCTTC GTCACCACCG TCGACCCTGT CGACGAGCCG ATACTCTACA CCGTGAACAC CTTCCTCTCC ATCCTCACCA
CCGACTACCC GGTGGACAGG TACGTCTGCT ACCTGTCCGA CGATGGCGGG ACACTGGCCA TGGACCCATG GTGGAGGTCG
CCAAGTTCGC CGAGCTGTGG GTGCCCTTCT GAGTGTAAAC CGATGTTTTT GTGTGTTTTT TGATAGGTTT TGCTGAACAA
TCCAAGCTGT AAACCGAGGC TTCGATTGGC AGCGAGTGCT GAGAATCCGG TTGATTTCAG TGGTGTTGAC GTGCGGCTCC
CCATGCTAGT GTACATCTCG CGCGAGAAGC CGTGCGCCGG GAAGCGCCAG TGCTCGAACC CCGCCGCCGC GTCGCCCGAC
CTCGCCGGCG CCTCCACCTG CGACAGCACG CACACGAGGG ACGTCACGTG GCTGCTCGCC AGCGAGTCGC CGAAGAACAG
CGCACGGCGC CTCCGCGTTC ACTGA

Locus: Os06g0213700

Loading...

Locus: Os06g0213700

Loading...