Os06t0216300-01

Locus

Os06g0216300

Description

Similar to 12-oxophytodienoic acid reductase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

OPR1

CGSNL Gene Name

12-OXOPHYTODIENOATE REDUCTASE 1

Oryzabase Gene Symbol Synonym(s)

OsOPR1, OsOPR2, OsOPR11, OsOPR06-6, OPDAR1, OsOPR, OPDAR

Oryzabase Gene Name Synonym(s)

12-oxo-phytodienoic acid reductase 1, OPDA reductase

Transcript Evidence

AK103067 (DDBJ, Best hit)

Protein Evidence

Q8H9F1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: FMN binding (GO:0010181)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

NADH:flavin oxidoreductase/NADH oxidase, N-terminal (IPR001155)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J033117P12 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0216300-01)

RiceXPro (AK103067)

Others

Oryzabase (8755)

KEGG (Os06t0216300-01 (EC:1.6.99.1))

Transcript

1519 bp

>Os06t0216300-01 Similar to 12-oxophytodienoic acid reductase.
AGAGCAACAAAGAACAGAGCAGAGCAGAGCAGCAGCAGCAAGAAACAGAGAGAGAAGCAG
AGCAATTTCGATCGAGAAGAACCAAAGCTACTCCTAAGCCAAAGATGGTGCACGCACCGG
CGAAAGTGGCAGCTGCGGCGGCGATCCCGCTGCTGACGCCGTACAAGATGGGGCAGCTGG
AGCTCTCCCACCGTGTGGTGCTCGCGCCGCTCACGCGGTGCCGCTCCTACGGCAACGTGC
CGCAGCCGCACGCGGCGGTGTACTACTCGCAGCGGGCGACCAGGGGCGGCCTCCTCATCG
CGGAGGCCACCGACATCTCCCCCACCGCGCAGGGCTACCCGGAGACCCCCGGCATCTACA
CGCAGCAGCAGATCGAGGCGTGGAAGCCCATCGTCGACGCCGTCCACCGCAAGGGCGCCC
TCTTCTTCCTGCAGATATGGCACGTCGGCAGGGTCTCCACCACAGGTTCGTCCATCTGCC
AGATTATTTACTTGCTAGTTGTTACTACTTGGTTACTGATTGATTCGAAGAATCAAAGGT
CATTGTGCTCTTTGATTGATTAAATTTCCAAATGAAATCGACAGATTTCCAGCCGAATGG
ACAGGCGCCGATCTCAAGCACCGACAAGCAGATCACACCGGACGATTCAGGCATGGTGTA
CTCCAAGCCCCGGCGGCTCCGGACGGATGAGATCCCTCAGATCATCGACGACTTCAGGCG
AGCCGCGCGGAACGCCATCGAGGCGGGGTTCGACGGCGTGGAGATTCATGGCGCGCACGG
CTACCTCCTGGAGCAGTTCATGAAGGACAGCGCCAACGACCGCACCGACGAGTACGGTGG
CAGCCTCGAGAACCGGTGCCGCTTCGCCGTCGAGGTGATCGACGCCGTCGTCGCCGAGGT
GGGAGCTCACCGTGTCGGAATCAGATTATCGCCGTTCGTCGACTTCATGGACTGCTTCGA
CTCCGACCCGGTGGCTCTCGGCTCATACATGGTGCAGCAACTCAACAAGCACCCAGGGTT
TCTCTACTGCCACATGGTGGAGCCAAGAATGGCCATAATCGAAGGACGAAGGAAGATCGC
CCATGGCCTCCTACCATTCAGGAAGCAGTTCAATGGCACTTTCATCGCTGCTGGCGGGTA
TGACCGGGAGGAAGGGAACAAGGTGGTGGCTGATGGCTATGCCGATCTCGTCGCCTATGG
GAGGCTCTTCTTGGCTAACCCTGACTTGCCGAGGAGGTTTGAGCTTGACGCACCATTGAA
CAGGTATGACAGGTCTACCTTTTATACACAGGATCCCGTTGTTGGCTATACAGATTACCC
TTTTCTTGAGGAGATTGATGAGGAGTCAAGAACTACTTATGCTTAATTGTCACCTAAATA
ATCCAATTTTAGCCTATTATTTGGATTAATAATGTAACACTTATCATGTGATACGGACAA
GCATGAATACATTTTTTTGTTGTAAGTTTGTAGCTGTTGATTCGAGATTAATGAGCTAAT
GTAATATTGATATTGTTCG

CDS

459 bp

>Os06t0216300-01 Similar to 12-oxophytodienoic acid reductase.
ATGGTGCACGCACCGGCGAAAGTGGCAGCTGCGGCGGCGATCCCGCTGCTGACGCCGTAC
AAGATGGGGCAGCTGGAGCTCTCCCACCGTGTGGTGCTCGCGCCGCTCACGCGGTGCCGC
TCCTACGGCAACGTGCCGCAGCCGCACGCGGCGGTGTACTACTCGCAGCGGGCGACCAGG
GGCGGCCTCCTCATCGCGGAGGCCACCGACATCTCCCCCACCGCGCAGGGCTACCCGGAG
ACCCCCGGCATCTACACGCAGCAGCAGATCGAGGCGTGGAAGCCCATCGTCGACGCCGTC
CACCGCAAGGGCGCCCTCTTCTTCCTGCAGATATGGCACGTCGGCAGGGTCTCCACCACA
GGTTCGTCCATCTGCCAGATTATTTACTTGCTAGTTGTTACTACTTGGTTACTGATTGAT
TCGAAGAATCAAAGGTCATTGTGCTCTTTGATTGATTAA

Protein

152 aa

>Os06t0216300-01 Similar to 12-oxophytodienoic acid reductase.
MVHAPAKVAAAAAIPLLTPYKMGQLELSHRVVLAPLTRCRSYGNVPQPHAAVYYSQRATR
GGLLIAEATDISPTAQGYPETPGIYTQQQIEAWKPIVDAVHRKGALFFLQIWHVGRVSTT
GSSICQIIYLLVVTTWLLIDSKNQRSLCSLID*

5'UTR

chr06:5919582..5919685 (- strand) : 104 bp

CDS

chr06:5919123..5919581 (- strand) : 459 bp

3'UTR

chr06:5918167..5919122 (- strand) : 956 bp

FASTA

>Os06t0216300-01 class=Sequence position=chr06:5918167..5919685 (- strand)
AGAGCAACAA AGAACAGAGC AGAGCAGAGC AGCAGCAGCA AGAAACAGAG AGAGAAGCAG AGCAATTTCG ATCGAGAAGA
ACCAAAGCTA CTCCTAAGCC AAAGATGGTG CACGCACCGG CGAAAGTGGC AGCTGCGGCG GCGATCCCGC TGCTGACGCC
GTACAAGATG GGGCAGCTGG AGCTCTCCCA CCGTGTGGTG CTCGCGCCGC TCACGCGGTG CCGCTCCTAC GGCAACGTGC
CGCAGCCGCA CGCGGCGGTG TACTACTCGC AGCGGGCGAC CAGGGGCGGC CTCCTCATCG CGGAGGCCAC CGACATCTCC
CCCACCGCGC AGGGCTACCC GGAGACCCCC GGCATCTACA CGCAGCAGCA GATCGAGGCG TGGAAGCCCA TCGTCGACGC
CGTCCACCGC AAGGGCGCCC TCTTCTTCCT GCAGATATGG CACGTCGGCA GGGTCTCCAC CACAGGTTCG TCCATCTGCC
AGATTATTTA CTTGCTAGTT GTTACTACTT GGTTACTGAT TGATTCGAAG AATCAAAGGT CATTGTGCTC TTTGATTGAT
TAAATTTCCA AATGAAATCG ACAGATTTCC AGCCGAATGG ACAGGCGCCG ATCTCAAGCA CCGACAAGCA GATCACACCG
GACGATTCAG GCATGGTGTA CTCCAAGCCC CGGCGGCTCC GGACGGATGA GATCCCTCAG ATCATCGACG ACTTCAGGCG
AGCCGCGCGG AACGCCATCG AGGCGGGGTT CGACGGCGTG GAGATTCATG GCGCGCACGG CTACCTCCTG GAGCAGTTCA
TGAAGGACAG CGCCAACGAC CGCACCGACG AGTACGGTGG CAGCCTCGAG AACCGGTGCC GCTTCGCCGT CGAGGTGATC
GACGCCGTCG TCGCCGAGGT GGGAGCTCAC CGTGTCGGAA TCAGATTATC GCCGTTCGTC GACTTCATGG ACTGCTTCGA
CTCCGACCCG GTGGCTCTCG GCTCATACAT GGTGCAGCAA CTCAACAAGC ACCCAGGGTT TCTCTACTGC CACATGGTGG
AGCCAAGAAT GGCCATAATC GAAGGACGAA GGAAGATCGC CCATGGCCTC CTACCATTCA GGAAGCAGTT CAATGGCACT
TTCATCGCTG CTGGCGGGTA TGACCGGGAG GAAGGGAACA AGGTGGTGGC TGATGGCTAT GCCGATCTCG TCGCCTATGG
GAGGCTCTTC TTGGCTAACC CTGACTTGCC GAGGAGGTTT GAGCTTGACG CACCATTGAA CAGGTATGAC AGGTCTACCT
TTTATACACA GGATCCCGTT GTTGGCTATA CAGATTACCC TTTTCTTGAG GAGATTGATG AGGAGTCAAG AACTACTTAT
GCTTAATTGT CACCTAAATA ATCCAATTTT AGCCTATTAT TTGGATTAAT AATGTAACAC TTATCATGTG ATACGGACAA
GCATGAATAC ATTTTTTTGT TGTAAGTTTG TAGCTGTTGA TTCGAGATTA ATGAGCTAAT GTAATATTGA TATTGTTCG

Locus: Os06g0216300

Loading...

Locus: Os06g0216300

Loading...