Os06t0216300-02

Locus

Os06g0216300

Description

12-oxophytodienoic acid reductase 1, Jasmonic acid (JA) biosynthesis, Defense response

RAP-DB Gene Symbol Synonym(s)

OsOPR1

RAP-DB Gene Name Synonym(s)

12-Oxophytodienoic Acid Reductase 1

CGSNL Gene Symbol

OPR1

CGSNL Gene Name

12-OXOPHYTODIENOATE REDUCTASE 1

Oryzabase Gene Symbol Synonym(s)

OsOPR1, OsOPR2, OsOPR11, OsOPR06-6, OPDAR1, OsOPR, OPDAR

Oryzabase Gene Name Synonym(s)

12-oxo-phytodienoic acid reductase 1, OPDA reductase

Transcript Evidence

AJ557138

Protein Evidence

Q84QK0

Literature

PMID: 18071256

PMID: 14559225

PMID: 12569412

Note

Manual Curation

March 1, 2021

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: FMN binding (GO:0010181)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Aldolase-type TIM barrel (IPR013785)

NADH:flavin oxidoreductase/NADH oxidase, N-terminal (IPR001155)

Others

Oryzabase (8755)

Transcript

1326 bp

>Os06t0216300-02 12-oxophytodienoic acid reductase 1, Jasmonic acid (JA) biosynthesis, Defense response
TTTCGATCGAGAAGAACCAAAGCTACTCCTAAGCCAAAGATGGTGCACGCACCGGCGAAA
GTGGCAGCTGCGGCGGCGATCCCGCTGCTGACGCCGTACAAGATGGGGCAGCTGGAGCTC
TCCCACCGTGTGGTGCTCGCGCCGCTCACGCGGTGCCGCTCCTACGGCAACGTGCCGCAG
CCGCACGCGGCGGTGTACTACTCGCAGCGGGCGACCAGGGGCGGCCTCCTCATCGCGGAG
GCCACCGACATCTCCCCCACCGCGCAGGGCTACCCGGAGACCCCCGGCATCTACACGCAG
CAGCAGATCGAGGCGTGGAAGCCCATCGTCGACGCCGTCCACCGCAAGGGCGCCCTCTTC
TTCCTGCAGATATGGCACGTCGGCAGGGTCTCCACCACAGATTTCCAGCCGAATGGACAG
GCGCCGATCTCAAGCACCGACAAGCAGATCACACCGGACGATTCAGGCATGGTGTACTCC
AAGCCCCGGCGGCTCCGGACGGATGAGATCCCTCAGATCATCGACGACTTCAGGCGAGCC
GCGCGGAACGCCATCGAGGCGGGGTTCGACGGCGTGGAGATTCATGGCGCGCACGGCTAC
CTCCTGGAGCAGTTCATGAAGGACAGCGCCAACGACCGCACCGACGAGTACGGTGGCAGC
CTCGAGAACCGGTGCCGCTTCGCCGTCGAGGTGATCGACGCCGTCGTCGCCGAGGTGGGA
GCTCACCGTGTCGGAATCAGATTATCGCCGTTCGTCGACTTCATGGACTGCTTCGACTCC
GACCCGGTGGCTCTCGGCTCATACATGGTGCAGCAACTCAACAAGCACCCAGGGTTTCTC
TACTGCCACATGGTGGAGCCAAGAATGGCCATAATCGAAGGACGAAGGAAGATCGCCCAT
GGCCTCCTACCATTCAGGAAGCAGTTCAATGGCACTTTCATCGCTGCTGGCGGGTATGAC
CGGGAGGAAGGGAACAAGGTGGTGGCTGATGGCTATGCCGATCTCGTCGCCTATGGGAGG
CTCTTCTTGGCTAACCCTGACTTGCCGAGGAGGTTTGAGCTTGACGCACCATTGAACAGG
TATGACAGGTCTACCTTTTATACACAGGATCCCGTTGTTGGCTATACAGATTACCCTTTT
CTTGAGGAGATTGATGAGGAGTCAAGAACTACTTATGCTTAATTGTCACCTAAATAATCC
AATTTTAGCCTATTATTTGGATTAATAATGTAACACTTATCATGTGATACGGACAAGCAT
GAATACATTTTTTTGTTGTAAGTTTGTAGCTGTTGATTCGAGATTAATGAGCTAATGTAA
TATTGA

CDS

1143 bp

>Os06t0216300-02 12-oxophytodienoic acid reductase 1, Jasmonic acid (JA) biosynthesis, Defense response
ATGGTGCACGCACCGGCGAAAGTGGCAGCTGCGGCGGCGATCCCGCTGCTGACGCCGTAC
AAGATGGGGCAGCTGGAGCTCTCCCACCGTGTGGTGCTCGCGCCGCTCACGCGGTGCCGC
TCCTACGGCAACGTGCCGCAGCCGCACGCGGCGGTGTACTACTCGCAGCGGGCGACCAGG
GGCGGCCTCCTCATCGCGGAGGCCACCGACATCTCCCCCACCGCGCAGGGCTACCCGGAG
ACCCCCGGCATCTACACGCAGCAGCAGATCGAGGCGTGGAAGCCCATCGTCGACGCCGTC
CACCGCAAGGGCGCCCTCTTCTTCCTGCAGATATGGCACGTCGGCAGGGTCTCCACCACA
GATTTCCAGCCGAATGGACAGGCGCCGATCTCAAGCACCGACAAGCAGATCACACCGGAC
GATTCAGGCATGGTGTACTCCAAGCCCCGGCGGCTCCGGACGGATGAGATCCCTCAGATC
ATCGACGACTTCAGGCGAGCCGCGCGGAACGCCATCGAGGCGGGGTTCGACGGCGTGGAG
ATTCATGGCGCGCACGGCTACCTCCTGGAGCAGTTCATGAAGGACAGCGCCAACGACCGC
ACCGACGAGTACGGTGGCAGCCTCGAGAACCGGTGCCGCTTCGCCGTCGAGGTGATCGAC
GCCGTCGTCGCCGAGGTGGGAGCTCACCGTGTCGGAATCAGATTATCGCCGTTCGTCGAC
TTCATGGACTGCTTCGACTCCGACCCGGTGGCTCTCGGCTCATACATGGTGCAGCAACTC
AACAAGCACCCAGGGTTTCTCTACTGCCACATGGTGGAGCCAAGAATGGCCATAATCGAA
GGACGAAGGAAGATCGCCCATGGCCTCCTACCATTCAGGAAGCAGTTCAATGGCACTTTC
ATCGCTGCTGGCGGGTATGACCGGGAGGAAGGGAACAAGGTGGTGGCTGATGGCTATGCC
GATCTCGTCGCCTATGGGAGGCTCTTCTTGGCTAACCCTGACTTGCCGAGGAGGTTTGAG
CTTGACGCACCATTGAACAGGTATGACAGGTCTACCTTTTATACACAGGATCCCGTTGTT
GGCTATACAGATTACCCTTTTCTTGAGGAGATTGATGAGGAGTCAAGAACTACTTATGCT
TAA

Protein

380 aa

>Os06t0216300-02 12-oxophytodienoic acid reductase 1, Jasmonic acid (JA) biosynthesis, Defense response
MVHAPAKVAAAAAIPLLTPYKMGQLELSHRVVLAPLTRCRSYGNVPQPHAAVYYSQRATR
GGLLIAEATDISPTAQGYPETPGIYTQQQIEAWKPIVDAVHRKGALFFLQIWHVGRVSTT
DFQPNGQAPISSTDKQITPDDSGMVYSKPRRLRTDEIPQIIDDFRRAARNAIEAGFDGVE
IHGAHGYLLEQFMKDSANDRTDEYGGSLENRCRFAVEVIDAVVAEVGAHRVGIRLSPFVD
FMDCFDSDPVALGSYMVQQLNKHPGFLYCHMVEPRMAIIEGRRKIAHGLLPFRKQFNGTF
IAAGGYDREEGNKVVADGYADLVAYGRLFLANPDLPRRFELDAPLNRYDRSTFYTQDPVV
GYTDYPFLEEIDEESRTTYA*

5'UTR

chr06:5919582..5919620 (- strand) : 39 bp

CDS

chr06:5919221..5919581 (- strand) : 361 bp

chr06:5918320..5919101 (- strand) : 782 bp

3'UTR

chr06:5918176..5918319 (- strand) : 144 bp

FASTA

>Os06t0216300-02 class=Sequence position=chr06:5918176..5919620 (- strand)
TTTCGATCGA GAAGAACCAA AGCTACTCCT AAGCCAAAGA TGGTGCACGC ACCGGCGAAA GTGGCAGCTG CGGCGGCGAT
CCCGCTGCTG ACGCCGTACA AGATGGGGCA GCTGGAGCTC TCCCACCGTG TGGTGCTCGC GCCGCTCACG CGGTGCCGCT
CCTACGGCAA CGTGCCGCAG CCGCACGCGG CGGTGTACTA CTCGCAGCGG GCGACCAGGG GCGGCCTCCT CATCGCGGAG
GCCACCGACA TCTCCCCCAC CGCGCAGGGC TACCCGGAGA CCCCCGGCAT CTACACGCAG CAGCAGATCG AGGCGTGGAA
GCCCATCGTC GACGCCGTCC ACCGCAAGGG CGCCCTCTTC TTCCTGCAGA TATGGCACGT CGGCAGGGTC TCCACCACAG
GTTCGTCCAT CTGCCAGATT ATTTACTTGC TAGTTGTTAC TACTTGGTTA CTGATTGATT CGAAGAATCA AAGGTCATTG
TGCTCTTTGA TTGATTAAAT TTCCAAATGA AATCGACAGA TTTCCAGCCG AATGGACAGG CGCCGATCTC AAGCACCGAC
AAGCAGATCA CACCGGACGA TTCAGGCATG GTGTACTCCA AGCCCCGGCG GCTCCGGACG GATGAGATCC CTCAGATCAT
CGACGACTTC AGGCGAGCCG CGCGGAACGC CATCGAGGCG GGGTTCGACG GCGTGGAGAT TCATGGCGCG CACGGCTACC
TCCTGGAGCA GTTCATGAAG GACAGCGCCA ACGACCGCAC CGACGAGTAC GGTGGCAGCC TCGAGAACCG GTGCCGCTTC
GCCGTCGAGG TGATCGACGC CGTCGTCGCC GAGGTGGGAG CTCACCGTGT CGGAATCAGA TTATCGCCGT TCGTCGACTT
CATGGACTGC TTCGACTCCG ACCCGGTGGC TCTCGGCTCA TACATGGTGC AGCAACTCAA CAAGCACCCA GGGTTTCTCT
ACTGCCACAT GGTGGAGCCA AGAATGGCCA TAATCGAAGG ACGAAGGAAG ATCGCCCATG GCCTCCTACC ATTCAGGAAG
CAGTTCAATG GCACTTTCAT CGCTGCTGGC GGGTATGACC GGGAGGAAGG GAACAAGGTG GTGGCTGATG GCTATGCCGA
TCTCGTCGCC TATGGGAGGC TCTTCTTGGC TAACCCTGAC TTGCCGAGGA GGTTTGAGCT TGACGCACCA TTGAACAGGT
ATGACAGGTC TACCTTTTAT ACACAGGATC CCGTTGTTGG CTATACAGAT TACCCTTTTC TTGAGGAGAT TGATGAGGAG
TCAAGAACTA CTTATGCTTA ATTGTCACCT AAATAATCCA ATTTTAGCCT ATTATTTGGA TTAATAATGT AACACTTATC
ATGTGATACG GACAAGCATG AATACATTTT TTTGTTGTAA GTTTGTAGCT GTTGATTCGA GATTAATGAG CTAATGTAAT
ATTGA

Locus: Os06g0216300

Loading...

Locus: Os06g0216300

Loading...