Os06t0216800-01

Locus

Os06g0216800

Description

Similar to Cyclophilin-40 (Expressed protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP40A

CGSNL Gene Name

CYCLOPHILIN 40A

Oryzabase Gene Symbol Synonym(s)

OsCYP40a, OsCYP-13, OsCYP40-1a, OsCYP40-1b

Oryzabase Gene Name Synonym(s)

cyclophilin 40a, cyclophilin 13

Transcript Evidence

AK068112 (DDBJ, Best hit)

Protein Evidence

NP_565381.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide TPR-1 (IPR001440)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing (IPR013026)

Cyclophilin-like (IPR015891)

Tetratricopeptide repeat (IPR019734)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Elongated TPR repeat-containing domain (IPR023114)

Full-length cDNA

J013134M21 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0216800-01)

RiceXPro (AK068112)

Others

Oryzabase (10070)

KEGG (Os06t0216800-01 (EC:5.2.1.8))

Transcript

1631 bp

>Os06t0216800-01 Similar to Cyclophilin-40 (Expressed protein).
GATGGCACCCACCCACAACGCAGCCTTCGCCGTTTGGCCCCCGAGGTAACCGACGGACAC
CACCACCACCGCGCCGCCTCGCCTCGTGAAGCTCCACTAGTTTCTAGGGTTTAGCCTAGC
CCCGACCCCgaggaggcccgagatcgcaatggagggcggcggcgagggcgcggagtcagc
agctgtcgcctccgcggcggcggcggaggtggaggtgaagaaCCCGAGGTGCTTCATGGA
CGTCAGCATCGGCGGCGAGATTGAGGGGAGGATCGTTATAGAGCTCTACGCGTCGGTGGT
GCCGCGGACGGCGGAGAACTTCCGCGCGCTCTGCACCGGGGAGAAGGGCGTCGGCGCCGT
CACCGGGAAGCACCTACACTACAAGGGATCTTGCTTCCATCGCGTTATCAAAGGCTTTAT
GGTACAAGGTGGAGATATAACTGCTGGTGATGGAACAGGAGGGGAGTCAATTTATGGGTT
GAAGTTTGAGGATGAGAATTTTGTTTTGAAGCATGAGAGGAAAGGAATGCTATCAATGGC
TAATTCTGGTCCCAACACAAATGGATCTCAGTTTTTCATCACTACAACTCGGACACCTCA
TTTAGATGGGAAACATGTAGTTTTTGGTAGAGTAATTAAGGGAATGGGGGTGGTTCGCTC
TGTTGAGCATGCTCCTGTTGGAGAGGCTGACCGCCCGACTTCTGATGTTGAAATTGTCGA
TTGTGGGGAACTTCCGGAAGGTGCTGATGATGGAGTTGTGAACTTCTTCAATGATGGTGA
TACGTATCCTGATTGGCCCAATGATCTTGATGAGAAGCCTATGGAGGTTTCATGGTGGAT
GGATGCTGTTGAGTCTGCTAAGGCTTTTGGGAATAATAATTTCAAGAAACAGGATTACAA
GGCAGCTCTGAGAAAGTACAGGAAAGCACTGCGTTACTTGGACGTTTGCTGGGAGAAAGA
AGATATAGATGAAGAGAAGAGCTCAGCACTGCGGAAGACCAAATCGATTATACTCACAAA
TAGCTCTGCATGCAAATTGAAGTTGGGAGATTTGAAGGGTGCTCTGTTGGATGCTGATTT
TGCACTGCGTGAAAGTGAGGGCAATGCTAAGGCATTTTTTCGACAAGGACAGGCACACAT
TGCACTCAATGACATTGATGCGGCAGTGGAGAGCTTCAAGCATGCATTGGAGTTGGAGCC
AAGTGATGGAGGAATTAAACGAGAGCTAGCTGCTGCAAAGAAGAAGATTGCCGACAGAAG
GAATCAGGAGCGGAAGGCATTTGCAAGGATGTTCCAACCTTCTGGAAAATCAGACAAAGA
CAATGAAGAGAGCAAGTGATCCCTAGTTTCCTTTCCCCGGCAGAACTTTTGGTAGCTTGA
TCTGGGATACATACTGGAACCGTGAAGAGGGTATAACAAGGGAGTCTGCGCAGCTAACGC
AAAAGACGCTGACTCCCTATCTAGATACAAGGAAAAAAAATAGTGGGGGAGAGGATAGCC
TTTGTTTTTCTTTTGCATTACTACAAAAGTAATTGTGCGTATCAACGCTGTTAAAGCCGA
GACATTGAACTGAACAGCACGGTTTCCACTTTTCAGACTTTGCTGCAAGGCATGCCAATG
GACATTTCCTT

CDS

1191 bp

>Os06t0216800-01 Similar to Cyclophilin-40 (Expressed protein).
atggagggcggcggcgagggcgcggagtcagcagctgtcgcctccgcggcggcggcggag
gtggaggtgaagaaCCCGAGGTGCTTCATGGACGTCAGCATCGGCGGCGAGATTGAGGGG
AGGATCGTTATAGAGCTCTACGCGTCGGTGGTGCCGCGGACGGCGGAGAACTTCCGCGCG
CTCTGCACCGGGGAGAAGGGCGTCGGCGCCGTCACCGGGAAGCACCTACACTACAAGGGA
TCTTGCTTCCATCGCGTTATCAAAGGCTTTATGGTACAAGGTGGAGATATAACTGCTGGT
GATGGAACAGGAGGGGAGTCAATTTATGGGTTGAAGTTTGAGGATGAGAATTTTGTTTTG
AAGCATGAGAGGAAAGGAATGCTATCAATGGCTAATTCTGGTCCCAACACAAATGGATCT
CAGTTTTTCATCACTACAACTCGGACACCTCATTTAGATGGGAAACATGTAGTTTTTGGT
AGAGTAATTAAGGGAATGGGGGTGGTTCGCTCTGTTGAGCATGCTCCTGTTGGAGAGGCT
GACCGCCCGACTTCTGATGTTGAAATTGTCGATTGTGGGGAACTTCCGGAAGGTGCTGAT
GATGGAGTTGTGAACTTCTTCAATGATGGTGATACGTATCCTGATTGGCCCAATGATCTT
GATGAGAAGCCTATGGAGGTTTCATGGTGGATGGATGCTGTTGAGTCTGCTAAGGCTTTT
GGGAATAATAATTTCAAGAAACAGGATTACAAGGCAGCTCTGAGAAAGTACAGGAAAGCA
CTGCGTTACTTGGACGTTTGCTGGGAGAAAGAAGATATAGATGAAGAGAAGAGCTCAGCA
CTGCGGAAGACCAAATCGATTATACTCACAAATAGCTCTGCATGCAAATTGAAGTTGGGA
GATTTGAAGGGTGCTCTGTTGGATGCTGATTTTGCACTGCGTGAAAGTGAGGGCAATGCT
AAGGCATTTTTTCGACAAGGACAGGCACACATTGCACTCAATGACATTGATGCGGCAGTG
GAGAGCTTCAAGCATGCATTGGAGTTGGAGCCAAGTGATGGAGGAATTAAACGAGAGCTA
GCTGCTGCAAAGAAGAAGATTGCCGACAGAAGGAATCAGGAGCGGAAGGCATTTGCAAGG
ATGTTCCAACCTTCTGGAAAATCAGACAAAGACAATGAAGAGAGCAAGTGA

Protein

397 aa

>Os06t0216800-01 Similar to Cyclophilin-40 (Expressed protein).
MEGGGEGAESAAVASAAAAEVEVKNPRCFMDVSIGGEIEGRIVIELYASVVPRTAENFRA
LCTGEKGVGAVTGKHLHYKGSCFHRVIKGFMVQGGDITAGDGTGGESIYGLKFEDENFVL
KHERKGMLSMANSGPNTNGSQFFITTTRTPHLDGKHVVFGRVIKGMGVVRSVEHAPVGEA
DRPTSDVEIVDCGELPEGADDGVVNFFNDGDTYPDWPNDLDEKPMEVSWWMDAVESAKAF
GNNNFKKQDYKAALRKYRKALRYLDVCWEKEDIDEEKSSALRKTKSIILTNSSACKLKLG
DLKGALLDADFALRESEGNAKAFFRQGQAHIALNDIDAAVESFKHALELEPSDGGIKREL
AAAKKKIADRRNQERKAFARMFQPSGKSDKDNEESK*

5'UTR

chr06:5939358..5939505 (- strand) : 148 bp

CDS

chr06:5939121..5939357 (- strand) : 237 bp

chr06:5936669..5937169 (- strand) : 501 bp

chr06:5936199..5936286 (- strand) : 88 bp

chr06:5936052..5936104 (- strand) : 53 bp

chr06:5935297..5935401 (- strand) : 105 bp

chr06:5934621..5934696 (- strand) : 76 bp

chr06:5934502..5934539 (- strand) : 38 bp

chr06:5934346..5934426 (- strand) : 81 bp

chr06:5934226..5934237 (- strand) : 12 bp

3'UTR

chr06:5934156..5934225 (- strand) : 70 bp

chr06:5933850..5934071 (- strand) : 222 bp

FASTA

>Os06t0216800-01 class=Sequence position=chr06:5933850..5939505 (- strand)
GATGGCACCC ACCCACAACG CAGCCTTCGC CGTTTGGCCC CCGAGGTAAC CGACGGACAC CACCACCACC GCGCCGCCTC
GCCTCGTGAA GCTCCACTAG TTTCTAGGGT TTAGCCTAGC CCCGACCCCg aggaggcccg agatcgcaat ggagggcggc
ggcgagggcg cggagtcagc agctgtcgcc tccgcggcgg cggcggaggt ggaggtgaag aaCCCGAGGT GCTTCATGGA
CGTCAGCATC GGCGGCGAGA TTGAGGGGAG GATCGTTATA GAGCTCTACG CGTCGGTGGT GCCGCGGACG GCGGAGAACT
TCCGCGCGCT CTGCACCGGG GAGAAGGGCG TCGGCGCCGT CACCGGGAAG CACCTACACT ACAAGGTGAG TACGGAACCG
CCGATTTGGA GCCATCGCCG AGGCCGAGAT GCTTGTGGCG TCCGGGTAGT CCCTTTCGGG GCTTTCTGCC GTGGTGGAGG
TTTAGGGTGT TGGGGAGTGG GGACTCGAAT TGGTTTCGTT GGGTGGAGGA GCGTCTTAGG CTCTGGATTT GGGCGGTAGT
ACTGCGCGCA ATGAATGATT CGATTCTGTT ATGTTTAGCA CATGTCTTGT GTCTTGGTGC GATTGACTGC CCACCGCTCC
CAATAAATTT TTAGGCGTCT GATCAGAGAC AGAGAACTGT TTTATTTTTC TTTTTTAATT TGGGCGATTG GTGATTGTTA
CTTTGTTAGG ATTTTGATGC GGATTTCATA AACATGCATT CTGAAACATT TGGGTTAGTT TACACTACTG CAAATCAGTT
CTAGTTTAGA GATTAAAAAG GTTCGGCCGG CCTTTGTGCC ACCGATTTGC TTTCCTAATG ATCATTTAGC GTGTTTATGG
GCAGCTGCAT CCTGCCATTG TATGGTCTTC TTTTGTCGTA TGGATATGTT CTTACTTATG CGGCCCATTT GGAATCTGTC
GATTTATTTT CCGGCTAATA TTTGTGCTGT GGTGTCAAAT CATTGTCCTT TGATATGAAA TGAACTCTAT GCACTGGTAC
TGCTGGTACA GCATGTTCTG ACTGTTAAAA CGGGCCCCCT CCATTTTGGC TTCCTTTTAT CTGCACCTTG CAGATATTAG
CCTATCAAGT ACCACCTGTG CTAACTTTTG TGGTTTGTCA TATGCCTGTG GAACAGTCAC AGTTTTCCTG TTAAAATTTG
GCAGATTCGT TATCTGCTAT TACAGTATGG TTAAGTCCAT GTATAAGAGT AGACAGTGAT GTACTCGCTC CATTGGCTTT
TGCCAAACTT TCACCTCTAT TTTTCTTTCC AATAAACTTG TAAGGAGGAA ATATTTAAAT AGCATCATTA ACCTACGCTC
GGTGAAAAAT CTAAGGACAC AAATATATTC ATTCAAACTG CTTGTCAAAT CGAACGGTGT GAAGTCTATT AAAACAGAAT
TACTGAAAAA GTTATTAATG GTCAAAATTT GCATAGTGTA ATGAACTGTG ACAATTAGAA GTAAACTAAG GCAGTAGTAC
ATATTAGACT TATACAATAT GTTGGGACAA GGGCTTGTGA CTTGATCACA TGAACGTTCT TTTGCACACG AGTAACCCCA
ATTCTTTTGC AGTAGACTAG TCCAGAAATT GGATATGGGG TACCAATTTC TGTGGCACTT TACTCTCAAA ATATTCCATG
TGCAGGTTAG CGATTAGCCT TGTGCAATCT GTATATAGGC GCTCCTTTTT TAATGGAGCA CATACAAGGC CTCATTGTTT
TACATATTGA CAGGTGGCCC AGCCACATGC ATGGATGTTT TGTTATTAGG TAGACATGAA GAGGGTTTTG TATGCGTATC
GTTAAGTAAT ATTCCGTACG CATAGAAAGG CCTCGTAGCC TTTTAGAATA GAATCAGAGA CAGTCACCAG TACTGTACCA
AGATTCTTTG CTAGCCATTT TTACTGTATA TTTTCATTAG TTTGACATTT AGTCTAGTAC AAGTTTTAGT GGTTACAGGA
GGAGCACATA ACATGCTGAC ATGGTTCTTG TTTGAATAGC TGCTTGGCAT TTTGTACCTC ATTTTAACTT CTGTTCATGG
AGCTAATGGA TGCATCTACT ACAGTAATAT TTTCTATATG ATTGAGTGGA TGGTTTCTTT TCTAGTTTGC TGTGCTCTTT
TTATTCCTTT TGCTTTTAAC ACCAAAAGAG GACAGTTCCA CTCTCTGTTA ACTTGGGATT TAAAAATGAT GATGAGAAAC
TTTGTCCTGA TACAACTGCA TATACTTCAC TGAAAACTGT TGTCACATCT TCACCGTAAT CTCTGAGACC ATGTCCGGTA
ATTGTTGTTC TTGTAGGGAT CTTGCTTCCA TCGCGTTATC AAAGGCTTTA TGGTACAAGG TGGAGATATA ACTGCTGGTG
ATGGAACAGG AGGGGAGTCA ATTTATGGGT TGAAGTTTGA GGATGAGAAT TTTGTTTTGA AGCATGAGAG GAAAGGAATG
CTATCAATGG CTAATTCTGG TCCCAACACA AATGGATCTC AGTTTTTCAT CACTACAACT CGGACACCTC ATTTAGATGG
GAAACATGTA GTTTTTGGTA GAGTAATTAA GGGAATGGGG GTGGTTCGCT CTGTTGAGCA TGCTCCTGTT GGAGAGGCTG
ACCGCCCGAC TTCTGATGTT GAAATTGTCG ATTGTGGGGA ACTTCCGGAA GGTGCTGATG ATGGAGTTGT GAACTTCTTC
AATGATGGTG ATACGTATCC TGATTGGCCC AATGATCTTG ATGAGAAGCC TATGGAGGTT TCATGGTGGA TGGATGCTGT
TGAGTCTGCT AAGGCTTTTG GGAATAATAA TTTCAAGGTA ATTTCCTCTT CAAGCTAATT TTCAAGTATT TTTATCTGTT
AGATTAATAT TGCATCATTT ACTAAATAAA ACCAAATCAG CAAAGTCAGG TGACGACAGC AAATCCTAAT CATGATTAAA
TGTTTAGGTT TTAGCTTAAG TTAGTGCATG GTAGTCCTTA CTTGTTCGAT ACCAGCTTCG ATAGTTCTAG TATTTACAGA
TTCATGTTTC TTAAGCCTTC TGCTGTTGAT TTTTGAATGG TTTAGTAGCC AAACTACTGC TGTTTTAATG AAATACCTGC
TTGTATCAGT TGAACAATTC TAGTTAATTA CTTTGGCACA ATTTAATATT TCATTATCTG TTTCCCTGAA GCTGAAGTTA
GTACTTCTGG TCTTTACAGA AACAGGATTA CAAGGCAGCT CTGAGAAAGT ACAGGAAAGC ACTGCGTTAC TTGGACGTTT
GCTGGGAGAA AGAAGATATA GATGAAGGCA ATTATACTGT CTCACTACAA CTGTTCAATG TTTGTTGTTT CTGTCACATG
ATGCATACTG ATCATAAACA CGTCACATAA CACTTATGCA GAGAAGAGCT CAGCACTGCG GAAGACCAAA TCGATTATAC
TCACAAATAG CTCTGTAAGT TGCATTATCT ATTCCAGTAA CTTATTTGTG GATGAACGTT TTGTCTTAAA GGAAACTGTT
ATTGTCATTT TATATTATCA TGAGTTACCT CTGCCACACT GCTTCCGCAC ATGGTTATGG GATTATAGCA ACTTGCAAAA
CATTTACTCC CTCTGTTCTA AAATATTCTG CGTGTTTCCC AAAGTGTACG TGGACGAAAG GATGTCCAGA TACATTTAAA
AAACACTCAG AAATACTTAT ATTTTTTGGA ACAGAGTTTG TAGAATAAAT AGTGCATGGG CATGGCGCAA GTTAGGTAGA
ATGTACATGG CTCGTGTATA TCCAATTACC TTTTTCTCAT GATCTGATTG TCCGTTGCTT TGCTCTAGGT TGTTTTCCTG
AGTTCATCTT TGAATACCTA TACACAACTA ACTGCAAAGC AGAGGAATAA ATTTTCTTTT AATTCCTTTA TCATTAGTTC
TAATATGATT TTAGAGTACT ATTGTATTCT CATCTAAACT TAAATCTTTG TGTTCATCGC TGCAAAATCC TTACCTACCC
TGCAGGAGCA GTGTCTTTCT GTTCCTGCTT GCTACTCACT CCGTACACAA ACTTCAAATT CGTGCTCTGT TGTTCACCTA
CATTGCCCTT CAAATCTTGT TCAGGCATGC AAATTGAAGT TGGGAGATTT GAAGGGTGCT CTGTTGGATG CTGATTTTGC
ACTGCGTGAA AGTGAGGGCA ATGCTAAGGC ATTTTTTCGA CAAGGACAGG TTGGTATTGA CCTGCAGTAA TGGTTTCACT
ATTTGCTGAT GCTTTTTTTC TCTGAACTAT GATTTATTTG TCTGCGTGCT TGTGAGCTTT GTTAATCGAA CCACTAAACC
ATCATATTGC TATTACCATT TGTTTGGGAC TATCAGTTCA TTTGCTTATT TTTAGATATT GATCTTATGA GTAAATTGCA
TTGTGCACTG GCACTCATTA TTAGTTTCAA TTTGCACTAG GGTGAACAAA TATTTCACTT CGCACCAGGT GGAGCGAAAT
ATGTTTCATT TTGCACCAGC CCAACCACTT GAAAATTGAC TCTGTTCACA TCTTGATAAG TATGGCCCAG CTATAGGTGA
GTTGTCCATA TGGGCATGCT GATGCTAGTG AGATGCTTGT CAGATTGCAA ACCTAGTAGA TGAGAGGTGC TTGGGTTGGT
GCAAAGTGAA TCTTAATTTG CTTTACCCTG GTGTGAGGTG AAAGTATTTG TTAAACCTAG CTCAAGGTGA AACTATTGAC
ATTTTAATCA ATGCAATGTG CTACTCATAT CGTATTATTA TTACCATCTG GTTTCTGCGC AACTCATATG GCATAAATGC
CATTTGCAGG CACACATTGC ACTCAATGAC ATTGATGCGG CAGTGGAGAG CTTCAAGCAT GCATTGGAGT TGGAGCCAAG
TGATGGTATC TCTTATTTTT CATATTCACT GGCAACACTT CTGTAATGTT GCAACCGCGT ATTTAATAAT CTTTTATAAT
CCTTAGGAGG AATTAAACGA GAGCTAGCTG CTGCAAAGAA GAAGGTCAGT CTGTAATTCT TGTGAACCTA GAATCTTGAT
AAATGCGCGT CGTTACCAAC TATATGCAAA TGATTACAGA TTGCCGACAG AAGGAATCAG GAGCGGAAGG CATTTGCAAG
GATGTTCCAA CCTTCTGGAA AATCAGACAA AGACAATGAA GTAATTCTCA AATGCCAATC CTTATCCTTT CTTCCCCCCT
TAATTTCTTA TCCAGGCTTT CAGCACTTAT CAAGCAAAGG TACTAATGGC TGTTTCGTTC TCCTGTAGGA GAGCAAGTGA
TCCCTAGTTT CCTTTCCCCG GCAGAACTTT TGGTAGCTTG ATCTGGGATA CATACTGGAA CCGTGAAGAG GTCCAAATTA
TACGATACGA CACCATTTAC ACTCTTTAAT TTTGTTAATA TATACTGATT AAATGATATG CTTTCTTTTT GCAGGGTATA
ACAAGGGAGT CTGCGCAGCT AACGCAAAAG ACGCTGACTC CCTATCTAGA TACAAGGAAA AAAAATAGTG GGGGAGAGGA
TAGCCTTTGT TTTTCTTTTG CATTACTACA AAAGTAATTG TGCGTATCAA CGCTGTTAAA GCCGAGACAT TGAACTGAAC
AGCACGGTTT CCACTTTTCA GACTTTGCTG CAAGGCATGC CAATGGACAT TTCCTT

Locus: Os06g0216800

Loading...

Locus: Os06g0216800

Loading...