Os06t0226500-01

Locus

Os06g0226500

Description

Helix-loop-helix protein, Brassinosteroid signaling

RAP-DB Gene Symbol Synonym(s)

BU1, ILI4, OsBU1

RAP-DB Gene Name Synonym(s)

BRASSINOSTEROID UPREGULATED 1, BRASSINOSTEROID UPREGULATED1, Increased Leaf Inclination4, BR upregulated 1

CGSNL Gene Symbol

BU1

CGSNL Gene Name

BRASSINOSTEROID UPREGULATED 1

Oryzabase Gene Symbol Synonym(s)

ILI4, OsILI4, OsBU1, BU1/ILI4, OsbHLH172, bHLH172

Oryzabase Gene Name Synonym(s)

BRASSINOSTEROID UPREGULATED1, Increased Leaf Inclination4, BR upregulated 1, basic helix-loop-helix protein 172

Transcript Evidence

AK071601 (Genbank)

Protein Evidence

Q0DDF6 (UniProt)

Literature

PMID: 19648232

Note

Manual Curation

October 9, 2009

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Full-length cDNA

J023102C01 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0226500-01)

RiceXPro (AK071601)

Others

Oryzabase (8783)

KEGG (Os06t0226500-01)

Transcript

798 bp

>Os06t0226500-01 Helix-loop-helix protein, Brassinosteroid signaling
AATTCCTACCTCACACTTCTGCAACAAGCTTTAGCTCCAGCCACCGGAACGAGAGATCGA
TACAGCTCGATCAGCTAGCCGCATTCGCCCTCGCCGCCGCCGACGATGTCGAGCCGGAGG
TCGTCGCGCTCCTCCGTGTCGGAGGAGGAGATCAACGAGCTCATCTCCAAGCTCCAGTCC
CTCCTCCCCAGCTCCCGCCGCCGCGGCGCCAACCAGGCGTCGACGACGAAGCTGCTGAAG
GAGACGTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTCAGCGACAGGCTC
TCCGACCTCATGGCCGGCATGGATCACAACAGCCCAGGCGCCGAGATCATCCGCAGCCTC
CTCCGCTAGCTCATCTCTTCTCATCTGTTCTTCCTCCTCGATGATCGATCGATCTCGTGT
TATTCTACGTACATGAAGGATGATATGAATGCAGCTCGTGCCCTGTAGCTACGTATAAAT
ATACACATATGTATACATGCATACAGTACATGATATGCATATGCCTAGATCTGATCTAGC
TCAGTAGAAAATCTACTCATCTCGGTGTACTACTGATGATGATGATGATTAAGGCATGCA
GCTGGCTTGATGATCGGTACTACTACTACTACTTCACTTCAGTTCAGTAGGGGCATTAGC
TAGCTAGCTAGGGCCGGCTGCCTAATTAAGTAATTAAGTAATTTATTATTTGTAGTAGCC
AGCTTGATCTCATCTCTCCTCATGAGCCATATGACATGTGGTTAAGTTAATTAATCCTTG
ATGCAGTAGAGTCGTCCC

CDS

264 bp

>Os06t0226500-01 Helix-loop-helix protein, Brassinosteroid signaling
ATGTCGAGCCGGAGGTCGTCGCGCTCCTCCGTGTCGGAGGAGGAGATCAACGAGCTCATC
TCCAAGCTCCAGTCCCTCCTCCCCAGCTCCCGCCGCCGCGGCGCCAACCAGGCGTCGACG
ACGAAGCTGCTGAAGGAGACGTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGAC
CTCAGCGACAGGCTCTCCGACCTCATGGCCGGCATGGATCACAACAGCCCAGGCGCCGAG
ATCATCCGCAGCCTCCTCCGCTAG

Protein

88 aa

>Os06t0226500-01 Helix-loop-helix protein, Brassinosteroid signaling
MSSRRSSRSSVSEEEINELISKLQSLLPSSRRRGANQASTTKLLKETCSYIKSLHREVDD
LSDRLSDLMAGMDHNSPGAEIIRSLLR*

5'UTR

chr06:6556697..6556801 (+ strand) : 105 bp

CDS

chr06:6556802..6556912 (+ strand) : 111 bp

chr06:6557167..6557319 (+ strand) : 153 bp

3'UTR

chr06:6557320..6557748 (+ strand) : 429 bp

FASTA

>Os06t0226500-01 class=Sequence position=chr06:6556697..6557748 (+ strand)
AATTCCTACC TCACACTTCT GCAACAAGCT TTAGCTCCAG CCACCGGAAC GAGAGATCGA TACAGCTCGA TCAGCTAGCC
GCATTCGCCC TCGCCGCCGC CGACGATGTC GAGCCGGAGG TCGTCGCGCT CCTCCGTGTC GGAGGAGGAG ATCAACGAGC
TCATCTCCAA GCTCCAGTCC CTCCTCCCCA GCTCCCGCCG CCGCGGCGCC AACCAGGTAC TACATTTCAC CGTTCTCATC
ACCACAAGTT CACATAACCA CCATGCACAC TAGCGGCATG AACAAGCTAG CTACATGAGT GATCGACGAT GTGTAGATTT
GTCGGGGTTC TAAATCTTCG GCTACAGCTG TTTGAGAAGG GTCTAGCTAT TTAACCACTA tagagggtct gccgttaaat
gtgttagccc gctatttaaa actCTCTAAT TAATTATTGT TGTTAATGGC GGATGCAAAA TAAAATGCAG GCGTCGACGA
CGAAGCTGCT GAAGGAGACG TGCAGCTACA TCAAGAGCCT GCACCGGGAG GTGGACGACC TCAGCGACAG GCTCTCCGAC
CTCATGGCCG GCATGGATCA CAACAGCCCA GGCGCCGAGA TCATCCGCAG CCTCCTCCGC TAGCTCATCT CTTCTCATCT
GTTCTTCCTC CTCGATGATC GATCGATCTC GTGTTATTCT ACGTACATGA AGGATGATAT GAATGCAGCT CGTGCCCTGT
AGCTACGTAT AAATATACAC ATATGTATAC ATGCATACAG TACATGATAT GCATATGCCT AGATCTGATC TAGCTCAGTA
GAAAATCTAC TCATCTCGGT GTACTACTGA TGATGATGAT GATTAAGGCA TGCAGCTGGC TTGATGATCG GTACTACTAC
TACTACTTCA CTTCAGTTCA GTAGGGGCAT TAGCTAGCTA GCTAGGGCCG GCTGCCTAAT TAAGTAATTA AGTAATTTAT
TATTTGTAGT AGCCAGCTTG ATCTCATCTC TCCTCATGAG CCATATGACA TGTGGTTAAG TTAATTAATC CTTGATGCAG
TAGAGTCGTC CC