Os06t0229400-00

Locus

Os06g0229400

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GELP81

CGSNL Gene Name

GDSL ESTERASE/LIPASE PROTEIN 81

Oryzabase Gene Symbol Synonym(s)

OsGELP81

Oryzabase Gene Name Synonym(s)

GDSL esterase/lipase protein 81

Transcript Evidence

BT063540 (DDBJ)

Protein Evidence

XP_002514748.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os06t0229400-00)

Others

Oryzabase (11031)

Transcript

1188 bp

>Os06t0229400-00 Conserved hypothetical protein.
ATGGCTTGCAAGAAGCAGAAGTCGAAGCTCATGGCATTTTCGCTGGCGATGGTGGTGGTG
GTGGTGCTGCTGCTGGGGCGGTGCCGCGGCGACGTGGTGCAGTTCATCttcggcgactcg
ctgtcggacgtgggcaacaacgactacctgaccaagagcctcgcccgcgccgcgctcccc
tggtacggcatcgacttcgacaccggcatgcccaacggccgcttctgcaacggccgcacc
gtcgccgacatcgtcggCGACAAGATGGGCCTCCCCCGCCCACCCGCCTTCCTCGACCCT
TCCCTCGACGAGAACGTCATCCTCAAGCGCGGCGTCAACTTCGCCTCCGGCGGCGGCGGC
ATCCTCAACGAGACCTCCTCCCTCTTTGTAAGTAGtactcctttcttctatatcgaatta
tacgaaattgttggctttccacAACTGAACCGAATATGTCACGCATGTGCGGTTGCAGAT
ACAGAGATTCTCGCTGTACAAGCAGATCGAGCTGTTCCAGGGGACGCAGGAGTTCATGCG
GCGCAAGGTCGGGAAGGCGGCGGCGGACAAGCTGTTCGGCGAGGCCTACTACGTGGTGGC
GATGGGCGCCAACGACTTCATCAACAACTACCTCCTCCCCGTCTACTCCGACTCGTGGAC
GTACAACGGCGACGCCTTCGTCCGCTACATGGTGACCACCCTGGAGGCGCAGCTGCGGCT
GCTCCACTCCctcggcgcgcggcggctcacgttcttcggcctggggcccatgggctgcat
cccgctgcagcggatcctgacctccacgggcgcgtgccaggagccgacgaacgcgctggc
gaggagcttcaacgagcaggcgggcgccgcggtggcgaggctgtcgtcgtcgctggcgaa
cgcgacgttcaggttcggggaggcgtacgactacttccaggacatcatcgaccgccccgc
ggcgcacgggttcaacaactcgcgggcgccgtgctgctcgctggggcgggtgcggccgac
gctgacgtgcacgccgctgtccacgctgtgcaaggaccggagccagtacgtgttctggga
cgagtaccaccccaccgaccgcgccaACGAGCTCATCGCGCTCGAGACGCTCCGCAAGCT
CAACATCACCGTCTCCGCCAACAACTCCACCTCAACCTAGCTAAGTAG

CDS

1188 bp

>Os06t0229400-00 Conserved hypothetical protein.
ATGGCTTGCAAGAAGCAGAAGTCGAAGCTCATGGCATTTTCGCTGGCGATGGTGGTGGTG
GTGGTGCTGCTGCTGGGGCGGTGCCGCGGCGACGTGGTGCAGTTCATCttcggcgactcg
ctgtcggacgtgggcaacaacgactacctgaccaagagcctcgcccgcgccgcgctcccc
tggtacggcatcgacttcgacaccggcatgcccaacggccgcttctgcaacggccgcacc
gtcgccgacatcgtcggCGACAAGATGGGCCTCCCCCGCCCACCCGCCTTCCTCGACCCT
TCCCTCGACGAGAACGTCATCCTCAAGCGCGGCGTCAACTTCGCCTCCGGCGGCGGCGGC
ATCCTCAACGAGACCTCCTCCCTCTTTGTAAGTAGtactcctttcttctatatcgaatta
tacgaaattgttggctttccacAACTGAACCGAATATGTCACGCATGTGCGGTTGCAGAT
ACAGAGATTCTCGCTGTACAAGCAGATCGAGCTGTTCCAGGGGACGCAGGAGTTCATGCG
GCGCAAGGTCGGGAAGGCGGCGGCGGACAAGCTGTTCGGCGAGGCCTACTACGTGGTGGC
GATGGGCGCCAACGACTTCATCAACAACTACCTCCTCCCCGTCTACTCCGACTCGTGGAC
GTACAACGGCGACGCCTTCGTCCGCTACATGGTGACCACCCTGGAGGCGCAGCTGCGGCT
GCTCCACTCCctcggcgcgcggcggctcacgttcttcggcctggggcccatgggctgcat
cccgctgcagcggatcctgacctccacgggcgcgtgccaggagccgacgaacgcgctggc
gaggagcttcaacgagcaggcgggcgccgcggtggcgaggctgtcgtcgtcgctggcgaa
cgcgacgttcaggttcggggaggcgtacgactacttccaggacatcatcgaccgccccgc
ggcgcacgggttcaacaactcgcgggcgccgtgctgctcgctggggcgggtgcggccgac
gctgacgtgcacgccgctgtccacgctgtgcaaggaccggagccagtacgtgttctggga
cgagtaccaccccaccgaccgcgccaACGAGCTCATCGCGCTCGAGACGCTCCGCAAGCT
CAACATCACCGTCTCCGCCAACAACTCCACCTCAACCTAGCTAAGTAG

Protein

396 aa

>Os06t0229400-00 Conserved hypothetical protein.
MACKKQKSKLMAFSLAMVVVVVLLLGRCRGDVVQFIFGDSLSDVGNNDYLTKSLARAALP
WYGIDFDTGMPNGRFCNGRTVADIVGDKMGLPRPPAFLDPSLDENVILKRGVNFASGGGG
ILNETSSLFVSSTPFFYIELYEIVGFPQLNRICHACAVADTEILAVQADRAVPGDAGVHA
AQGREGGGGQAVRRGLLRGGDGRQRLHQQLPPPRLLRLVDVQRRRLRPLHGDHPGGAAAA
APLPRRAAAHVLRPGAHGLHPAAADPDLHGRVPGADERAGEELQRAGGRRGGEAVVVAGE
RDVQVRGGVRLLPGHHRPPRGARVQQLAGAVLLAGAGAADADVHAAVHAVQGPEPVRVLG
RVPPHRPRQRAHRARDAPQAQHHRLRQQLHLNLAK*

CDS

chr06:6736085..6736526 (+ strand) : 442 bp

chr06:6736941..6737686 (+ strand) : 746 bp

FASTA

>Os06t0229400-00 class=Sequence position=chr06:6736085..6737686 (+ strand)
ATGGCTTGCA AGAAGCAGAA GTCGAAGCTC ATGGCATTTT CGCTGGCGAT GGTGGTGGTG GTGGTGCTGC TGCTGGGGCG
GTGCCGCGGC GACGTGGTGC AGTTCATCtt cggcgactcg ctgtcggacg tgggcaacaa cgactacctg accaagagcc
tcgcccgcgc cgcgctcccc tggtacggca tcgacttcga caccggcatg cccaacggcc gcttctgcaa cggccgcacc
gtcgccgaca tcgtcggCGA CAAGATGGGC CTCCCCCGCC CACCCGCCTT CCTCGACCCT TCCCTCGACG AGAACGTCAT
CCTCAAGCGC GGCGTCAACT TCGCCTCCGG CGGCGGCGGC ATCCTCAACG AGACCTCCTC CCTCTTTGTA AGTAGtactc
ctttcttcta tatcgaatta tacgaaattg ttggctttcc acgtaacgtt taatcattat tttattaaaa aaaattatat
aaatattatt tattttTtcg tttgactttt ttcttaacca atgttcttta tgtttgatta aatttataga aaaaattata
aacaacatca aattagtttt attaaattta acattgaata tgttttgata atatatttat tttgtattaa aaatattaat
atgttttcta taacgactaa gaaaaaaatc ttaatatgtt ttctataacg actaagaaaa aattaaataa cttataatat
gaaaTGAAAA TGGAAGGGTA TGATTTTAAC TTATGCTTTT ACATATAAAT GGTTAAATAT TATAGAAAAG TTAATGAAGT
TATATATTTT GGGATAGAGG TTGCCAAGAA TTTATCTTGT GCTCGGTGAA CTGAAGAACT GAACCGAATA TGTCACGCAT
GTGCGGTTGC AGATACAGAG ATTCTCGCTG TACAAGCAGA TCGAGCTGTT CCAGGGGACG CAGGAGTTCA TGCGGCGCAA
GGTCGGGAAG GCGGCGGCGG ACAAGCTGTT CGGCGAGGCC TACTACGTGG TGGCGATGGG CGCCAACGAC TTCATCAACA
ACTACCTCCT CCCCGTCTAC TCCGACTCGT GGACGTACAA CGGCGACGCC TTCGTCCGCT ACATGGTGAC CACCCTGGAG
GCGCAGCTGC GGCTGCTCCA CTCCctcggc gcgcggcggc tcacgttctt cggcctgggg cccatgggct gcatcccgct
gcagcggatc ctgacctcca cgggcgcgtg ccaggagccg acgaacgcgc tggcgaggag cttcaacgag caggcgggcg
ccgcggtggc gaggctgtcg tcgtcgctgg cgaacgcgac gttcaggttc ggggaggcgt acgactactt ccaggacatc
atcgaccgcc ccgcggcgca cgggttcaac aactcgcggg cgccgtgctg ctcgctgggg cgggtgcggc cgacgctgac
gtgcacgccg ctgtccacgc tgtgcaagga ccggagccag tacgtgttct gggacgagta ccaccccacc gaccgcgcca
ACGAGCTCAT CGCGCTCGAG ACGCTCCGCA AGCTCAACAT CACCGTCTCC GCCAACAACT CCACCTCAAC CTAGCTAAGT
AG