Os06t0234200-01

Locus

Os06g0234200

Description

Similar to Rac-like GTP-binding protein 4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC4

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 4

Oryzabase Gene Symbol Synonym(s)

OsRAC4, OsRac4, ROP4, OsRop4

Oryzabase Gene Name Synonym(s)

Rac-like GTP-binding protein 4, GTPase protein ROP4, Rac/Rop-type GTPase 4

Transcript Evidence

AK063083 (DDBJ, Best hit)

Protein Evidence

D9ZHB7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTP-binding protein domain (IPR005225)

Full-length cDNA

001-111-A05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0234200-01)

RiceXPro (AK063083)

Others

Oryzabase (6767)

KEGG (Os06t0234200-01)

Transcript

750 bp

>Os06t0234200-01 Similar to Rac-like GTP-binding protein 4.
AATCAGTATAGACAGTAGTGAGAACAGTTCAGAGAGGAAGCATGTGACACTTCCCTCTGT
CCCTCTCTCTCTCTCTAGCCTCCAACCATCGCTTCACCAAGAAGCCATCACCTCCTCCTC
TCTATCAAGTTCTCTCCCCTCTCTTGCTGTCTCTGCTTGCTGCTGCTGCTGCTCGATTCG
GCCGGCGGCCATGGCGTCCAGCGCGTCGCGGTTCATCAAGTGCGTCACGGTCGGGGACGG
CGCCGTCGGCAAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGATTA
CGTACCCACTGTTTTTGACAATTTCAGTGCAAACGTGGTGGTCGACGGCACCACGGTGAA
TTTGGGTCTCTGGGATACTGCAGGGCAGGAAGATTACAACAGATTGAGGCCGCTAAGCTA
CCGTGGCGCCGATGTCTTTGTGCTTGCCTTCTCCCTAGTGAGCCGAGCTAGCTATGAGAA
TGTCATGAAGAAGGTTCAGAAAAAAAAAATCTCTTGCAATTAATCTGTTAAACCCATAAT
GTGGATGCATTCAGAGAGATTCAGTATTTCAGTTAGGTTTACCTTGTGCTTTTTGTCCCC
TTGAAGTGGTTACCAGAGCTTCAGCATTATGCACCAGGGGTGCCAATTGTGTTGGTTGGG
ACCAAATTGGGTGAGTTGTGTGACAGTGAAAGCACAATTTCCATTTTATTGCATATCCCC
TTGGCTGTGATAATAGAACTGGTGTGCTGT

CDS

333 bp

>Os06t0234200-01 Similar to Rac-like GTP-binding protein 4.
ATGGCGTCCAGCGCGTCGCGGTTCATCAAGTGCGTCACGGTCGGGGACGGCGCCGTCGGC
AAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGATTACGTACCCACT
GTTTTTGACAATTTCAGTGCAAACGTGGTGGTCGACGGCACCACGGTGAATTTGGGTCTC
TGGGATACTGCAGGGCAGGAAGATTACAACAGATTGAGGCCGCTAAGCTACCGTGGCGCC
GATGTCTTTGTGCTTGCCTTCTCCCTAGTGAGCCGAGCTAGCTATGAGAATGTCATGAAG
AAGGTTCAGAAAAAAAAAATCTCTTGCAATTAA

Protein

111 aa

>Os06t0234200-01 Similar to Rac-like GTP-binding protein 4.
MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGL
WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKVQKKKISCN*

5'UTR

chr06:6990939..6991128 (+ strand) : 190 bp

CDS

chr06:6991129..6991233 (+ strand) : 105 bp

chr06:6991572..6991659 (+ strand) : 88 bp

chr06:6991789..6991928 (+ strand) : 140 bp

3'UTR

chr06:6991929..6992155 (+ strand) : 227 bp

FASTA

>Os06t0234200-01 class=Sequence position=chr06:6990939..6992155 (+ strand)
AATCAGTATA GACAGTAGTG AGAACAGTTC AGAGAGGAAG CATGTGACAC TTCCCTCTGT CCCTCTCTCT CTCTCTAGCC
TCCAACCATC GCTTCACCAA GAAGCCATCA CCTCCTCCTC TCTATCAAGT TCTCTCCCCT CTCTTGCTGT CTCTGCTTGC
TGCTGCTGCT GCTCGATTCG GCCGGCGGCC ATGGCGTCCA GCGCGTCGCG GTTCATCAAG TGCGTCACGG TCGGGGACGG
CGCCGTCGGC AAGACCTGCA TGCTCATCTG CTACACCAGC AACAAGTTCC CCACTGTAAT GCAAAATGCA AACCTTTTTG
CTCCATCCTA TCTGTTTTCT GTTCATTCCT TTCGGAAAAG ATTCGGGGTT TTTCTTGATT TCGTCGAAAT TTCGGGATTC
TTCATTTGCC TGCTCCAGCT GTAACTTCTT CTAGATTTTC CTTTCTTGTT CTTGATTTCT TGGGGACTCT GGTATAGTGG
TATGCTTGTA TGGAAACAAG AGGTGGTATC ATTGTTGAGT TACAGAAAAA CTCTGTTCTT GTGTGTGTTT TCTTCCTGAA
TCACAGTTAA TATTTCAATT CAAATTTGTT GCATGTTTAT AACTTCTTTT TGTTTTTGTT TGGCCTTCTG CAGGATTACG
TACCCACTGT TTTTGACAAT TTCAGTGCAA ACGTGGTGGT CGACGGCACC ACGGTGAATT TGGGTCTCTG GGATACTGCA
GGTAATTTTT GTAATTCCTT TGCAGATGCT TTGTTTGTTC TACATTTCCA GGTAATTTTA CTAATCCTTC CAGCTGAAAA
AAAATTTCAT TCTTGTGATG CTGATAGTGT GGACTTCAAA TTGTTTACAG GGCAGGAAGA TTACAACAGA TTGAGGCCGC
TAAGCTACCG TGGCGCCGAT GTCTTTGTGC TTGCCTTCTC CCTAGTGAGC CGAGCTAGCT ATGAGAATGT CATGAAGAAG
GTTCAGAAAA AAAAAATCTC TTGCAATTAA TCTGTTAAAC CCATAATGTG GATGCATTCA GAGAGATTCA GTATTTCAGT
TAGGTTTACC TTGTGCTTTT TGTCCCCTTG AAGTGGTTAC CAGAGCTTCA GCATTATGCA CCAGGGGTGC CAATTGTGTT
GGTTGGGACC AAATTGGGTG AGTTGTGTGA CAGTGAAAGC ACAATTTCCA TTTTATTGCA TATCCCCTTG GCTGTGATAA
TAGAACTGGT GTGCTGT

Locus: Os06g0234200

Loading...

Locus: Os06g0234200

Loading...