Os06t0234200-02

Locus

Os06g0234200

Description

Similar to Rac-like GTP-binding protein 4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC4

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 4

Oryzabase Gene Symbol Synonym(s)

OsRAC4, OsRac4, ROP4, OsRop4

Oryzabase Gene Name Synonym(s)

Rac-like GTP-binding protein 4, GTPase protein ROP4, Rac/Rop-type GTPase 4

Transcript Evidence

AK067253 (DDBJ, Best hit)

Protein Evidence

D9ZHB7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTP-binding protein domain (IPR005225)

Full-length cDNA

J013098K11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0234200-02)

RiceXPro (AK067253)

Others

Oryzabase (6767)

KEGG (Os06t0234200-02)

Transcript

2514 bp

>Os06t0234200-02 Similar to Rac-like GTP-binding protein 4.
ATAGACAGTAGTGAGAACAGTTCAGAGAGGAAGCATGTGACACTTCCCTCTGTCCCTCTC
TCTCTCTCTAGCCTCCAACCATCGCTTCACCAAGAAGCCATCACCTCCTCCTCTCTATCA
AGTTCTCTCCCCTCTCTTGCTGTCTCTGCTTGCTGCTGCTGCTGCTCGATTCGGCCGGCG
GCCATGGCGTCCAGCGCGTCGCGGTTCATCAAGTGCGTCACGGTCGGGGACGGCGCCGTC
GGCAAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGATTACGTACCC
ACTGTTTTTGACAATTTCAGTGCAAACGTGGTGGTCGACGGCACCACGGTGAATTTGGGT
CTCTGGGATACTGCAGGGCAGGAAGATTACAACAGATTGAGGCCGCTAAGCTACCGTGGC
GCCGATGTCTTTGTGCTTGCCTTCTCCCTAGTGAGCCGAGCTAGCTATGAGAATGTCATG
AAGAAGGTTCAGAAAAAAAAAATCTCTTGCAATTAATCTGTTAAACCCATAATGTGGATG
CATTCAGAGAGATTCAGTATTTCAGTTAGGTTTACCTTGTGCTTTTTGTCCCCTTGAAGT
GGTTACCAGAGCTTCAGCATTATGCACCAGGGGTGCCAATTGTGTTGGTTGGGACCAAAT
TGGGTGAGTTGTGTGACAGTGAAAGCACAATTTCCATTTTATTGCATATCCCCTTGGCTG
TGATAATAGAACTGGTGTGCTGTACATCCTCTGTCTAAGCTTGTCACTTGCTGGTAGTGA
TTTGGATGATTTTGTCTTTTCATTCTTGGAGCATGGAATTGTGTGGTCCCTAAAAATATT
GATGGACCTATAATAGTTACTATAACTCACCAAGATTTAGTCCTTGCGATGTTTAAGTAG
GAACTATTGCATTTTGTACGTTCTGTCTTGTACCTTGCCAGTAGTATTTCACCGGCTCGG
ATCAATTTACCTTATCACTGTTGGATTATGATTCCTCAAGGAATTGTTTGGAACTATCTT
AATTTTTATTTCACTAAGATTAGTTGCACTACATTATTTTATTTTCTCTGAACAAAATAA
AAGTAAATCGTAGTTAAAAAAAGAGAGGCAAGGTTTATGAATGAGCCAATGAGGTTTCTT
TCTCTTTTTTTTTCACTCAAACAATTTCAAAACCTCCATAATTGATGTTTGGAAATACCA
ATTCTTGTTTTCTTCaaatggaaaagtccaactacctccttaaacttatgatagaagtcc
atttagcacgttgaactttaaaaccggacaaccaaccccctaaactttgcaatgccgttt
atataacctcctaaggtgattttgaatagtggttttacgtatttgggatcttaaacaagc
agctttaaataacttatataatacatttatgtatcatcaattgtagtttgtcaatttata
atatagagtgatgtcatattatttttacaatggtataagtgagagcgaacaagggataaa
aagaaatatttaagtgaaaattttaacatatgcgtatgtcacatgatcaaagctcatcca
atttatatgccaattaaataaaacaactttgtaaaaccaccttagggttccatatgaatg
gtattgtaaagttagggggttgaatttccgatttcaaacttcaggattctagatggactt
tcaatgaaagtttaggggtttatttggactttttctgctttAAATTGAAGCTTATTTGTT
AGTAACTTACCGAAGCAAGAATTCGGTTTCCGGAACTCAAAGTTCCAAGCTCTTACCTAG
ATGGGAGACACTATATTCCTTTGCAGTTAATCATCTAACATAGTAACCACTACAATTAAT
TAAACAGATGATAATTCTCTAGTACTAAATACTTAAGTAAAATAAATGTTGCACCTGTTT
TAAAAGGAAGGTTGCACTTCAGTAATATTGAATGAAATAGGCTAGTGAAATTTACCTAGT
AATTATGCTGATCATGTTTTCAAGTTTCTTGCATTTCGCCTTGGATTTTTATTTTTTTTT
TGAAAACCAAGCCTACAATCTTATCTTGCAACAAATCTCAATCAGTTACTGTTCAATTAA
ACCACAACTTTTGTCGACCATACAGATCTTCGTGAAGATAAACACTACTTACTTGACCAT
CCTAGCTTGGTGCCTGTGACTACAGCACAGGGAGAGGAACTCCGCAAGCACATTGGCGCA
ACGTGTTACATCGAATGCAGCTCAAAGACACAGCAGAATGTAAAAGCTGTGTTTGATGCT
GCCATCAAGGTAGTAAtcaagcctccaacaaagcagagggacaggaagaagaagaaaaca
cggcgcGGATGTTCTTTCTTCTGCAAGGGTGTCATGTCCAGAAGAAGGCTAGTATGCTTC
AAGTGAACAAGAGGGGTTCTTTGATGAGCAGAGCAGAGGTCTGTGAGACAAAATGATGTC
TTGTGTTTGATAATTGCTTTATCTCAAAAGTTCCAGTTTGATAGTTGCATTTCC

CDS

333 bp

>Os06t0234200-02 Similar to Rac-like GTP-binding protein 4.
ATGGCGTCCAGCGCGTCGCGGTTCATCAAGTGCGTCACGGTCGGGGACGGCGCCGTCGGC
AAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGATTACGTACCCACT
GTTTTTGACAATTTCAGTGCAAACGTGGTGGTCGACGGCACCACGGTGAATTTGGGTCTC
TGGGATACTGCAGGGCAGGAAGATTACAACAGATTGAGGCCGCTAAGCTACCGTGGCGCC
GATGTCTTTGTGCTTGCCTTCTCCCTAGTGAGCCGAGCTAGCTATGAGAATGTCATGAAG
AAGGTTCAGAAAAAAAAAATCTCTTGCAATTAA

Protein

111 aa

>Os06t0234200-02 Similar to Rac-like GTP-binding protein 4.
MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGL
WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKVQKKKISCN*

5'UTR

chr06:6990946..6991128 (+ strand) : 183 bp

CDS

chr06:6991129..6991233 (+ strand) : 105 bp

chr06:6991572..6991659 (+ strand) : 88 bp

chr06:6991789..6991928 (+ strand) : 140 bp

3'UTR

chr06:6991929..6993602 (+ strand) : 1674 bp

chr06:6993740..6993805 (+ strand) : 66 bp

chr06:6993908..6994011 (+ strand) : 104 bp

chr06:6994151..6994304 (+ strand) : 154 bp

FASTA

>Os06t0234200-02 class=Sequence position=chr06:6990946..6994304 (+ strand)
ATAGACAGTA GTGAGAACAG TTCAGAGAGG AAGCATGTGA CACTTCCCTC TGTCCCTCTC TCTCTCTCTA GCCTCCAACC
ATCGCTTCAC CAAGAAGCCA TCACCTCCTC CTCTCTATCA AGTTCTCTCC CCTCTCTTGC TGTCTCTGCT TGCTGCTGCT
GCTGCTCGAT TCGGCCGGCG GCCATGGCGT CCAGCGCGTC GCGGTTCATC AAGTGCGTCA CGGTCGGGGA CGGCGCCGTC
GGCAAGACCT GCATGCTCAT CTGCTACACC AGCAACAAGT TCCCCACTGT AATGCAAAAT GCAAACCTTT TTGCTCCATC
CTATCTGTTT TCTGTTCATT CCTTTCGGAA AAGATTCGGG GTTTTTCTTG ATTTCGTCGA AATTTCGGGA TTCTTCATTT
GCCTGCTCCA GCTGTAACTT CTTCTAGATT TTCCTTTCTT GTTCTTGATT TCTTGGGGAC TCTGGTATAG TGGTATGCTT
GTATGGAAAC AAGAGGTGGT ATCATTGTTG AGTTACAGAA AAACTCTGTT CTTGTGTGTG TTTTCTTCCT GAATCACAGT
TAATATTTCA ATTCAAATTT GTTGCATGTT TATAACTTCT TTTTGTTTTT GTTTGGCCTT CTGCAGGATT ACGTACCCAC
TGTTTTTGAC AATTTCAGTG CAAACGTGGT GGTCGACGGC ACCACGGTGA ATTTGGGTCT CTGGGATACT GCAGGTAATT
TTTGTAATTC CTTTGCAGAT GCTTTGTTTG TTCTACATTT CCAGGTAATT TTACTAATCC TTCCAGCTGA AAAAAAATTT
CATTCTTGTG ATGCTGATAG TGTGGACTTC AAATTGTTTA CAGGGCAGGA AGATTACAAC AGATTGAGGC CGCTAAGCTA
CCGTGGCGCC GATGTCTTTG TGCTTGCCTT CTCCCTAGTG AGCCGAGCTA GCTATGAGAA TGTCATGAAG AAGGTTCAGA
AAAAAAAAAT CTCTTGCAAT TAATCTGTTA AACCCATAAT GTGGATGCAT TCAGAGAGAT TCAGTATTTC AGTTAGGTTT
ACCTTGTGCT TTTTGTCCCC TTGAAGTGGT TACCAGAGCT TCAGCATTAT GCACCAGGGG TGCCAATTGT GTTGGTTGGG
ACCAAATTGG GTGAGTTGTG TGACAGTGAA AGCACAATTT CCATTTTATT GCATATCCCC TTGGCTGTGA TAATAGAACT
GGTGTGCTGT ACATCCTCTG TCTAAGCTTG TCACTTGCTG GTAGTGATTT GGATGATTTT GTCTTTTCAT TCTTGGAGCA
TGGAATTGTG TGGTCCCTAA AAATATTGAT GGACCTATAA TAGTTACTAT AACTCACCAA GATTTAGTCC TTGCGATGTT
TAAGTAGGAA CTATTGCATT TTGTACGTTC TGTCTTGTAC CTTGCCAGTA GTATTTCACC GGCTCGGATC AATTTACCTT
ATCACTGTTG GATTATGATT CCTCAAGGAA TTGTTTGGAA CTATCTTAAT TTTTATTTCA CTAAGATTAG TTGCACTACA
TTATTTTATT TTCTCTGAAC AAAATAAAAG TAAATCGTAG TTAAAAAAAG AGAGGCAAGG TTTATGAATG AGCCAATGAG
GTTTCTTTCT CTTTTTTTTT CACTCAAACA ATTTCAAAAC CTCCATAATT GATGTTTGGA AATACCAATT CTTGTTTTCT
TCaaatggaa aagtccaact acctccttaa acttatgata gaagtccatt tagcacgttg aactttaaaa ccggacaacc
aaccccctaa actttgcaat gccgtttata taacctccta aggtgatttt gaatagtggt tttacgtatt tgggatctta
aacaagcagc tttaaataac ttatataata catttatgta tcatcaattg tagtttgtca atttataata tagagtgatg
tcatattatt tttacaatgg tataagtgag agcgaacaag ggataaaaag aaatatttaa gtgaaaattt taacatatgc
gtatgtcaca tgatcaaagc tcatccaatt tatatgccaa ttaaataaaa caactttgta aaaccacctt agggttccat
atgaatggta ttgtaaagtt agggggttga atttccgatt tcaaacttca ggattctaga tggactttca atgaaagttt
aggggtttat ttggactttt tctgctttAA ATTGAAGCTT ATTTGTTAGT AACTTACCGA AGCAAGAATT CGGTTTCCGG
AACTCAAAGT TCCAAGCTCT TACCTAGATG GGAGACACTA TATTCCTTTG CAGTTAATCA TCTAACATAG TAACCACTAC
AATTAATTAA ACAGATGATA ATTCTCTAGT ACTAAATACT TAAGTAAAAT AAATGTTGCA CCTGTTTTAA AAGGAAGGTT
GCACTTCAGT AATATTGAAT GAAATAGGCT AGTGAAATTT ACCTAGTAAT TATGCTGATC ATGTTTTCAA GTTTCTTGCA
TTTCGCCTTG GATTTTTATT TTTTTTTTGA AAACCAAGCC TACAATCTTA TCTTGCAACA AATCTCAATC AGTTACTGTT
CAATTAAACC ACAACTTTTG TCGACCATAC AGATCTTCGT GAAGATAAAC ACTACTTACT TGACCATCCT AGCTTGGTGC
CTGTGACTAC AGCACAGGTA TTATTCTCCA GTACCTATGC ACTCTGCATA CCTGAGGACT GAAAATTTCA CAGTAAATCT
CTGCAAAATT TTGAGATATC ACTGCATTCC AGCATCTTAC ATTTCTGTGT TCTCCTGCAA TGCTTATCTT GCAGGGAGAG
GAACTCCGCA AGCACATTGG CGCAACGTGT TACATCGAAT GCAGCTCAAA GACACAGCAG GTTAATTTCT CATGTTGCCT
CTCTATGCTC CTGAAGGTGC CTACATTTCA ATCCTGAAGA TATAGCTTGG GTAATCCCTT AACAAATATC AATAATATGT
AGAATGTAAA AGCTGTGTTT GATGCTGCCA TCAAGGTAGT AAtcaagcct ccaacaaagc agagggacag gaagaagaag
aaaacacggc gcGGATGTTC TTTCTTGTGA GTGAATATGC TGCAAAATTT TAGCTTTCTC ACGTCAATGT CTGTGAATTT
GTAGTCATGT AGACTGTTAT TTTTCTGCTT AATTCTTGGA GAGTTTTTAT TTAAGATGCT AAGTCCTTTT TCTTTGGCAT
TGCAGCTGCA AGGGTGTCAT GTCCAGAAGA AGGCTAGTAT GCTTCAAGTG AACAAGAGGG GTTCTTTGAT GAGCAGAGCA
GAGGTCTGTG AGACAAAATG ATGTCTTGTG TTTGATAATT GCTTTATCTC AAAAGTTCCA GTTTGATAGT TGCATTTCC

Locus: Os06g0234200

Loading...

Locus: Os06g0234200

Loading...