Os06t0234200-03

Locus

Os06g0234200

Description

Similar to RAC-like GTP binding protein ARAC8 (GTPase protein ROP10).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC4

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 4

Oryzabase Gene Symbol Synonym(s)

OsRAC4, OsRac4, ROP4, OsRop4

Oryzabase Gene Name Synonym(s)

Rac-like GTP-binding protein 4, GTPase protein ROP4, Rac/Rop-type GTPase 4

Transcript Evidence

AK061102 (DDBJ, Best hit)

Protein Evidence

D9ZHB7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

006-207-B05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0234200-03)

RiceXPro (AK061102)

Others

Oryzabase (6767)

KEGG (Os06t0234200-03)

Transcript

1128 bp

>Os06t0234200-03 Similar to RAC-like GTP binding protein ARAC8 (GTPase protein ROP10).
ATGTGACACTTCCCTCTGTCCCTCTCTCTCTCTCTAGCCTCCAACCATCGCTTCACCAAG
AAGCCATCACCTCCTCCTCTCTATCAAGTTCTCTCCCCTCTCTTGCTGTCTCTGCTTGCT
GCTGCTGCTGCTCGATTCGGCCGGCGGCCATGGCGTCCAGCGCGTCGCGGTTCATCAAGT
GCGTCACGGTCGGGGACGGCGCCGTCGGCAAGACCTGCATGCTCATCTGCTACACCAGCA
ACAAGTTCCCCACTGATTACGTACCCACTGTTTTTGACAATTTCAGTGCAAACGTGGTGG
TCGACGGCACCACGGTGAATTTGGGTCTCTGGGATACTGCAGGGCAGGAAGATTACAACA
GATTGAGGCCGCTAAGCTACCGTGGCGCCGATGTCTTTGTGCTTGCCTTCTCCCTAGTGA
GCCGAGCTAGCTATGAGAATGTCATGAAGAAGTGGTTACCAGAGCTTCAGCATTATGCAC
CAGGGGTGCCAATTGTGTTGGTTGGGACCAAATTGGATCTTCGTGAAGATAAACACTACT
TACTTGACCATCCTAGCTTGGTGCCTGTGACTACAGCACAGGGAGAGGAACTCCGCAAGC
ACATTGGCGCAACGTGTTACATCGAATGCAGCTCAAAGACACAGCAGAATGTAAAAGCTG
TGTTTGATGCTGCCATCAAGGTAGTAAtcaagcctccaacaaagcagagggacaggaaga
agaagaaaacacggcgcGGATGTTCTTTCTTCTGCAAGGGTGTCATGTCCAGAAGAAGGC
TAGTATGCTTCAAGTGAACAAGAGGGGTTCTTTGATGAGCAGAGCAGAGGTCTGTGAGAC
AAAATGATGTCTTGTGTTTGATAATTGCTTTATCTCAAAAGTTCCAGTTTGATAGTTGCA
TTTCCAACCTATATATATCCTGTTTGGCAATTAACtactacctccgtcccaaaatataac
aacttttggctatgaatctgaacgcacagttatccagattcatagctaaaaatacttata
ttttgggacggagggagtaCTAGTAGTAGATTACTATCCTGTCCATGTAATGTATTAGGA
AGGTTAATAGCACTCCCTACATCTCAGAATGGAAGTTGTTTTGGTTTT

CDS

648 bp

>Os06t0234200-03 Similar to RAC-like GTP binding protein ARAC8 (GTPase protein ROP10).
ATGGCGTCCAGCGCGTCGCGGTTCATCAAGTGCGTCACGGTCGGGGACGGCGCCGTCGGC
AAGACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACTGATTACGTACCCACT
GTTTTTGACAATTTCAGTGCAAACGTGGTGGTCGACGGCACCACGGTGAATTTGGGTCTC
TGGGATACTGCAGGGCAGGAAGATTACAACAGATTGAGGCCGCTAAGCTACCGTGGCGCC
GATGTCTTTGTGCTTGCCTTCTCCCTAGTGAGCCGAGCTAGCTATGAGAATGTCATGAAG
AAGTGGTTACCAGAGCTTCAGCATTATGCACCAGGGGTGCCAATTGTGTTGGTTGGGACC
AAATTGGATCTTCGTGAAGATAAACACTACTTACTTGACCATCCTAGCTTGGTGCCTGTG
ACTACAGCACAGGGAGAGGAACTCCGCAAGCACATTGGCGCAACGTGTTACATCGAATGC
AGCTCAAAGACACAGCAGAATGTAAAAGCTGTGTTTGATGCTGCCATCAAGGTAGTAAtc
aagcctccaacaaagcagagggacaggaagaagaagaaaacacggcgcGGATGTTCTTTC
TTCTGCAAGGGTGTCATGTCCAGAAGAAGGCTAGTATGCTTCAAGTGA

Protein

216 aa

>Os06t0234200-03 Similar to RAC-like GTP binding protein ARAC8 (GTPase protein ROP10).
MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGL
WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLVGT
KLDLREDKHYLLDHPSLVPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAAIKVVI
KPPTKQRDRKKKKTRRGCSFFCKGVMSRRRLVCFK*

5'UTR

chr06:6990980..6991128 (+ strand) : 149 bp

CDS

chr06:6991129..6991233 (+ strand) : 105 bp

chr06:6991572..6991659 (+ strand) : 88 bp

chr06:6991789..6991898 (+ strand) : 110 bp

chr06:6992012..6992075 (+ strand) : 64 bp

chr06:6993538..6993602 (+ strand) : 65 bp

chr06:6993740..6993805 (+ strand) : 66 bp

chr06:6993908..6994011 (+ strand) : 104 bp

chr06:6994151..6994196 (+ strand) : 46 bp

3'UTR

chr06:6994197..6994527 (+ strand) : 331 bp

FASTA

>Os06t0234200-03 class=Sequence position=chr06:6990980..6994527 (+ strand)
ATGTGACACT TCCCTCTGTC CCTCTCTCTC TCTCTAGCCT CCAACCATCG CTTCACCAAG AAGCCATCAC CTCCTCCTCT
CTATCAAGTT CTCTCCCCTC TCTTGCTGTC TCTGCTTGCT GCTGCTGCTG CTCGATTCGG CCGGCGGCCA TGGCGTCCAG
CGCGTCGCGG TTCATCAAGT GCGTCACGGT CGGGGACGGC GCCGTCGGCA AGACCTGCAT GCTCATCTGC TACACCAGCA
ACAAGTTCCC CACTGTAATG CAAAATGCAA ACCTTTTTGC TCCATCCTAT CTGTTTTCTG TTCATTCCTT TCGGAAAAGA
TTCGGGGTTT TTCTTGATTT CGTCGAAATT TCGGGATTCT TCATTTGCCT GCTCCAGCTG TAACTTCTTC TAGATTTTCC
TTTCTTGTTC TTGATTTCTT GGGGACTCTG GTATAGTGGT ATGCTTGTAT GGAAACAAGA GGTGGTATCA TTGTTGAGTT
ACAGAAAAAC TCTGTTCTTG TGTGTGTTTT CTTCCTGAAT CACAGTTAAT ATTTCAATTC AAATTTGTTG CATGTTTATA
ACTTCTTTTT GTTTTTGTTT GGCCTTCTGC AGGATTACGT ACCCACTGTT TTTGACAATT TCAGTGCAAA CGTGGTGGTC
GACGGCACCA CGGTGAATTT GGGTCTCTGG GATACTGCAG GTAATTTTTG TAATTCCTTT GCAGATGCTT TGTTTGTTCT
ACATTTCCAG GTAATTTTAC TAATCCTTCC AGCTGAAAAA AAATTTCATT CTTGTGATGC TGATAGTGTG GACTTCAAAT
TGTTTACAGG GCAGGAAGAT TACAACAGAT TGAGGCCGCT AAGCTACCGT GGCGCCGATG TCTTTGTGCT TGCCTTCTCC
CTAGTGAGCC GAGCTAGCTA TGAGAATGTC ATGAAGAAGG TTCAGAAAAA AAAAATCTCT TGCAATTAAT CTGTTAAACC
CATAATGTGG ATGCATTCAG AGAGATTCAG TATTTCAGTT AGGTTTACCT TGTGCTTTTT GTCCCCTTGA AGTGGTTACC
AGAGCTTCAG CATTATGCAC CAGGGGTGCC AATTGTGTTG GTTGGGACCA AATTGGGTGA GTTGTGTGAC AGTGAAAGCA
CAATTTCCAT TTTATTGCAT ATCCCCTTGG CTGTGATAAT AGAACTGGTG TGCTGTACAT CCTCTGTCTA AGCTTGTCAC
TTGCTGGTAG TGATTTGGAT GATTTTGTCT TTTCATTCTT GGAGCATGGA ATTGTGTGGT CCCTAAAAAT ATTGATGGAC
CTATAATAGT TACTATAACT CACCAAGATT TAGTCCTTGC GATGTTTAAG TAGGAACTAT TGCATTTTGT ACGTTCTGTC
TTGTACCTTG CCAGTAGTAT TTCACCGGCT CGGATCAATT TACCTTATCA CTGTTGGATT ATGATTCCTC AAGGAATTGT
TTGGAACTAT CTTAATTTTT ATTTCACTAA GATTAGTTGC ACTACATTAT TTTATTTTCT CTGAACAAAA TAAAAGTAAA
TCGTAGTTAA AAAAAGAGAG GCAAGGTTTA TGAATGAGCC AATGAGGTTT CTTTCTCTTT TTTTTTCACT CAAACAATTT
CAAAACCTCC ATAATTGATG TTTGGAAATA CCAATTCTTG TTTTCTTCaa atggaaaagt ccaactacct ccttaaactt
atgatagaag tccatttagc acgttgaact ttaaaaccgg acaaccaacc ccctaaactt tgcaatgccg tttatataac
ctcctaaggt gattttgaat agtggtttta cgtatttggg atcttaaaca agcagcttta aataacttat ataatacatt
tatgtatcat caattgtagt ttgtcaattt ataatataga gtgatgtcat attattttta caatggtata agtgagagcg
aacaagggat aaaaagaaat atttaagtga aaattttaac atatgcgtat gtcacatgat caaagctcat ccaatttata
tgccaattaa ataaaacaac tttgtaaaac caccttaggg ttccatatga atggtattgt aaagttaggg ggttgaattt
ccgatttcaa acttcaggat tctagatgga ctttcaatga aagtttaggg gtttatttgg actttttctg ctttAAATTG
AAGCTTATTT GTTAGTAACT TACCGAAGCA AGAATTCGGT TTCCGGAACT CAAAGTTCCA AGCTCTTACC TAGATGGGAG
ACACTATATT CCTTTGCAGT TAATCATCTA ACATAGTAAC CACTACAATT AATTAAACAG ATGATAATTC TCTAGTACTA
AATACTTAAG TAAAATAAAT GTTGCACCTG TTTTAAAAGG AAGGTTGCAC TTCAGTAATA TTGAATGAAA TAGGCTAGTG
AAATTTACCT AGTAATTATG CTGATCATGT TTTCAAGTTT CTTGCATTTC GCCTTGGATT TTTATTTTTT TTTTGAAAAC
CAAGCCTACA ATCTTATCTT GCAACAAATC TCAATCAGTT ACTGTTCAAT TAAACCACAA CTTTTGTCGA CCATACAGAT
CTTCGTGAAG ATAAACACTA CTTACTTGAC CATCCTAGCT TGGTGCCTGT GACTACAGCA CAGGTATTAT TCTCCAGTAC
CTATGCACTC TGCATACCTG AGGACTGAAA ATTTCACAGT AAATCTCTGC AAAATTTTGA GATATCACTG CATTCCAGCA
TCTTACATTT CTGTGTTCTC CTGCAATGCT TATCTTGCAG GGAGAGGAAC TCCGCAAGCA CATTGGCGCA ACGTGTTACA
TCGAATGCAG CTCAAAGACA CAGCAGGTTA ATTTCTCATG TTGCCTCTCT ATGCTCCTGA AGGTGCCTAC ATTTCAATCC
TGAAGATATA GCTTGGGTAA TCCCTTAACA AATATCAATA ATATGTAGAA TGTAAAAGCT GTGTTTGATG CTGCCATCAA
GGTAGTAAtc aagcctccaa caaagcagag ggacaggaag aagaagaaaa cacggcgcGG ATGTTCTTTC TTGTGAGTGA
ATATGCTGCA AAATTTTAGC TTTCTCACGT CAATGTCTGT GAATTTGTAG TCATGTAGAC TGTTATTTTT CTGCTTAATT
CTTGGAGAGT TTTTATTTAA GATGCTAAGT CCTTTTTCTT TGGCATTGCA GCTGCAAGGG TGTCATGTCC AGAAGAAGGC
TAGTATGCTT CAAGTGAACA AGAGGGGTTC TTTGATGAGC AGAGCAGAGG TCTGTGAGAC AAAATGATGT CTTGTGTTTG
ATAATTGCTT TATCTCAAAA GTTCCAGTTT GATAGTTGCA TTTCCAACCT ATATATATCC TGTTTGGCAA TTAACtacta
cctccgtccc aaaatataac aacttttggc tatgaatctg aacgcacagt tatccagatt catagctaaa aatacttata
ttttgggacg gagggagtaC TAGTAGTAGA TTACTATCCT GTCCATGTAA TGTATTAGGA AGGTTAATAG CACTCCCTAC
ATCTCAGAAT GGAAGTTGTT TTGGTTTT

Locus: Os06g0234200

Loading...

Locus: Os06g0234200

Loading...