Os06t0235200-01

Locus

Os06g0235200

Description

Protein of unknown function DUF231 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL40, TBL40

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 40

Transcript Evidence

AK240937 (DDBJ, Best hit)

Protein Evidence

NP_001057240.2 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

J065041L24 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0235200-01)

Others

Oryzabase (21495)

KEGG (Os06t0235200-01)

Transcript

1761 bp

>Os06t0235200-01 Protein of unknown function DUF231 domain containing protein.
GATCCCTTTCTTCTCCCCATCCCTCTTTGCCATGGTTTCCGCATCTTGAGCTGAGCAGAG
CACAGCTTGTACCTGCAGCCAGCCATGGTGACCACCAATTTCGTGCAGAACCACCACCTT
CAGAACAGCCAGTTCTTCCTGCTCCCCAAGAGGCAGCTTGTGACCTACGCCCTCTACGCT
CTCATCCCTCTCGCCCTCCTCCATTACCTTCTCTTCAACCCTGTGGCCACTGCCAAGAAG
CCGGTGGTGGTGGTGGTTCAGGCGACAGACGATGCTTCGGTCATCGCCTCGTCTCATCAC
GAGCATGTCAAGGTGAATGCCAAGCAGCTGCCTGTGCCCCCTTCTGACCAAGGAGATGAA
GGGTTCAAGAAGAATGCGATAGCCGGAGAAGTGGCGGCGGCGGCGGCGTGCGACTACTCC
GACGGCGAGTGGGTGCCGGACGCGCGGCCGCCTCTCTACAACGGGACGAGCTGCGCCACG
ATCAAGGATGGGCAGAACTGCATGGCgcacggccggccggacaccggctacctccactgg
cggtggcggccgcggcggtgcgacctcccggcgttctcgccggaggcgttcctcggctgg
ctccgcggcaagcacctcgcgttcgtcggcgactcgctggcgcgcaaccaggcggagtcg
ctggtgtgcctcctggcgtcccgctccacgccggagctcgtgcaccgcgacggcgaggag
aacaggttccggcggtgggcgttccgggagcacgacgccaccgtgtccatcttctggtcg
ccgttcctcgtcaaggccgcggagaaggcggagcgcgccggcgtgcggcacaacaacgtg
ttcctggacgcgttcgacgagcggtggatgtccgggctggggggcctcgacgccgTCGTG
CTCTCCATCGGGCACTGGTTCCTGATCCCGGGCATCTACCACGACGCCGGCGAGGTCGTC
GGCTGCCACGACTGCGCCGAGTTCAACCACACCGAGACCCCCTTCTTCGCCGTGTTCAGG
CAGGCGGTCCACCGGACGCTCGCCGAGATCACCCGGCGCCACGTCCTCGCCGCCGGCGCG
GGCACGAGCAAGAGCAAGAGCAAGGTGGTGGCGTTCACGACGTTCTCGCCGGCGCACTTC
GAGGGGGAGTGGGACAAGGCCGGCGCGTGCAACAAGACGCGGCCGTACAAGAACGGCGAG
AAGGAGGCCGGGTACACGGAGGCGGAGATGCGCAAGACCGTCGTGGAAGAGGTCGCCGCC
GCCGACGCCGCCGCGGCCGGCGGCGGCGGCGCGGGCCTGCGGTTCGCGGCGCTGGACGTG
ACGACGCTGGCCAACCTGCGGCCCGACGGGCACCCGGGCCCGTACATGCGCGGCGACCCG
TTCGCCGGCGGCGGCGGCGGCGCGCGGGTGCAGAACGACTGCGTGCACTGGTGCCTCCCC
GGCGCCATCGACACGTTCAACGAGATTCTGCTCCAGACCATCACCAGATGACGACGTTGA
TAAGATGAATCGTTTCGTCTCGTTTACGAGATCATACGAGTAGATAGTGCGAATTCCGCG
GTAAAAATGGTTTGGTTTAGATCTCAGTGATTTTTGGGTGTCGCCTTTGATGTAGCTGTA
ATTGTTAgagcatatacaatagcaggctataagtccgttataaacataagtccgttataa
acatattttaaagagatatatgaaaagataggagagcagcgggctacagatctgtagcca
gctgcagcatgggaattggct

CDS

1407 bp

>Os06t0235200-01 Protein of unknown function DUF231 domain containing protein.
ATGGTGACCACCAATTTCGTGCAGAACCACCACCTTCAGAACAGCCAGTTCTTCCTGCTC
CCCAAGAGGCAGCTTGTGACCTACGCCCTCTACGCTCTCATCCCTCTCGCCCTCCTCCAT
TACCTTCTCTTCAACCCTGTGGCCACTGCCAAGAAGCCGGTGGTGGTGGTGGTTCAGGCG
ACAGACGATGCTTCGGTCATCGCCTCGTCTCATCACGAGCATGTCAAGGTGAATGCCAAG
CAGCTGCCTGTGCCCCCTTCTGACCAAGGAGATGAAGGGTTCAAGAAGAATGCGATAGCC
GGAGAAGTGGCGGCGGCGGCGGCGTGCGACTACTCCGACGGCGAGTGGGTGCCGGACGCG
CGGCCGCCTCTCTACAACGGGACGAGCTGCGCCACGATCAAGGATGGGCAGAACTGCATG
GCgcacggccggccggacaccggctacctccactggcggtggcggccgcggcggtgcgac
ctcccggcgttctcgccggaggcgttcctcggctggctccgcggcaagcacctcgcgttc
gtcggcgactcgctggcgcgcaaccaggcggagtcgctggtgtgcctcctggcgtcccgc
tccacgccggagctcgtgcaccgcgacggcgaggagaacaggttccggcggtgggcgttc
cgggagcacgacgccaccgtgtccatcttctggtcgccgttcctcgtcaaggccgcggag
aaggcggagcgcgccggcgtgcggcacaacaacgtgttcctggacgcgttcgacgagcgg
tggatgtccgggctggggggcctcgacgccgTCGTGCTCTCCATCGGGCACTGGTTCCTG
ATCCCGGGCATCTACCACGACGCCGGCGAGGTCGTCGGCTGCCACGACTGCGCCGAGTTC
AACCACACCGAGACCCCCTTCTTCGCCGTGTTCAGGCAGGCGGTCCACCGGACGCTCGCC
GAGATCACCCGGCGCCACGTCCTCGCCGCCGGCGCGGGCACGAGCAAGAGCAAGAGCAAG
GTGGTGGCGTTCACGACGTTCTCGCCGGCGCACTTCGAGGGGGAGTGGGACAAGGCCGGC
GCGTGCAACAAGACGCGGCCGTACAAGAACGGCGAGAAGGAGGCCGGGTACACGGAGGCG
GAGATGCGCAAGACCGTCGTGGAAGAGGTCGCCGCCGCCGACGCCGCCGCGGCCGGCGGC
GGCGGCGCGGGCCTGCGGTTCGCGGCGCTGGACGTGACGACGCTGGCCAACCTGCGGCCC
GACGGGCACCCGGGCCCGTACATGCGCGGCGACCCGTTCGCCGGCGGCGGCGGCGGCGCG
CGGGTGCAGAACGACTGCGTGCACTGGTGCCTCCCCGGCGCCATCGACACGTTCAACGAG
ATTCTGCTCCAGACCATCACCAGATGA

Protein

469 aa

>Os06t0235200-01 Protein of unknown function DUF231 domain containing protein.
MVTTNFVQNHHLQNSQFFLLPKRQLVTYALYALIPLALLHYLLFNPVATAKKPVVVVVQA
TDDASVIASSHHEHVKVNAKQLPVPPSDQGDEGFKKNAIAGEVAAAAACDYSDGEWVPDA
RPPLYNGTSCATIKDGQNCMAHGRPDTGYLHWRWRPRRCDLPAFSPEAFLGWLRGKHLAF
VGDSLARNQAESLVCLLASRSTPELVHRDGEENRFRRWAFREHDATVSIFWSPFLVKAAE
KAERAGVRHNNVFLDAFDERWMSGLGGLDAVVLSIGHWFLIPGIYHDAGEVVGCHDCAEF
NHTETPFFAVFRQAVHRTLAEITRRHVLAAGAGTSKSKSKVVAFTTFSPAHFEGEWDKAG
ACNKTRPYKNGEKEAGYTEAEMRKTVVEEVAAADAAAAGGGGAGLRFAALDVTTLANLRP
DGHPGPYMRGDPFAGGGGGARVQNDCVHWCLPGAIDTFNEILLQTITR*

5'UTR

chr06:7045543..7045626 (- strand) : 84 bp

CDS

chr06:7045245..7045542 (- strand) : 298 bp

chr06:7043884..7044992 (- strand) : 1109 bp

3'UTR

chr06:7043614..7043883 (- strand) : 270 bp

FASTA

>Os06t0235200-01 class=Sequence position=chr06:7043614..7045626 (- strand)
GATCCCTTTC TTCTCCCCAT CCCTCTTTGC CATGGTTTCC GCATCTTGAG CTGAGCAGAG CACAGCTTGT ACCTGCAGCC
AGCCATGGTG ACCACCAATT TCGTGCAGAA CCACCACCTT CAGAACAGCC AGTTCTTCCT GCTCCCCAAG AGGCAGCTTG
TGACCTACGC CCTCTACGCT CTCATCCCTC TCGCCCTCCT CCATTACCTT CTCTTCAACC CTGTGGCCAC TGCCAAGAAG
CCGGTGGTGG TGGTGGTTCA GGCGACAGAC GATGCTTCGG TCATCGCCTC GTCTCATCAC GAGCATGTCA AGGTGAATGC
CAAGCAGCTG CCTGTGCCCC CTTCTGACCA AGGAGATGAA GGGTTCAAGA AGAATGCGAT AGGTGAGATA TTGGGATCTC
TTGTCGATTT CGAGTACCTA GGATTTTTTT TTCCATGATG AGATTTGTCT GCCCCGATTG GTTTTCTCCA TTTCTTGATG
TTTTTGGATT ATCGGATTCT GGGCATTAGA TTTGTGATGT TTCTTGTGCA GATTTTAGCA TGTATGAACA GATTTGAGTT
CTTGGGGATT TAATTGGGGG AGGGAAGGGC ATCCTTTTGG GCTAATCTTT GCATCTTGTG TTGGATCCGA GCAGCCGGAG
AAGTGGCGGC GGCGGCGGCG TGCGACTACT CCGACGGCGA GTGGGTGCCG GACGCGCGGC CGCCTCTCTA CAACGGGACG
AGCTGCGCCA CGATCAAGGA TGGGCAGAAC TGCATGGCgc acggccggcc ggacaccggc tacctccact ggcggtggcg
gccgcggcgg tgcgacctcc cggcgttctc gccggaggcg ttcctcggct ggctccgcgg caagcacctc gcgttcgtcg
gcgactcgct ggcgcgcaac caggcggagt cgctggtgtg cctcctggcg tcccgctcca cgccggagct cgtgcaccgc
gacggcgagg agaacaggtt ccggcggtgg gcgttccggg agcacgacgc caccgtgtcc atcttctggt cgccgttcct
cgtcaaggcc gcggagaagg cggagcgcgc cggcgtgcgg cacaacaacg tgttcctgga cgcgttcgac gagcggtgga
tgtccgggct ggggggcctc gacgccgTCG TGCTCTCCAT CGGGCACTGG TTCCTGATCC CGGGCATCTA CCACGACGCC
GGCGAGGTCG TCGGCTGCCA CGACTGCGCC GAGTTCAACC ACACCGAGAC CCCCTTCTTC GCCGTGTTCA GGCAGGCGGT
CCACCGGACG CTCGCCGAGA TCACCCGGCG CCACGTCCTC GCCGCCGGCG CGGGCACGAG CAAGAGCAAG AGCAAGGTGG
TGGCGTTCAC GACGTTCTCG CCGGCGCACT TCGAGGGGGA GTGGGACAAG GCCGGCGCGT GCAACAAGAC GCGGCCGTAC
AAGAACGGCG AGAAGGAGGC CGGGTACACG GAGGCGGAGA TGCGCAAGAC CGTCGTGGAA GAGGTCGCCG CCGCCGACGC
CGCCGCGGCC GGCGGCGGCG GCGCGGGCCT GCGGTTCGCG GCGCTGGACG TGACGACGCT GGCCAACCTG CGGCCCGACG
GGCACCCGGG CCCGTACATG CGCGGCGACC CGTTCGCCGG CGGCGGCGGC GGCGCGCGGG TGCAGAACGA CTGCGTGCAC
TGGTGCCTCC CCGGCGCCAT CGACACGTTC AACGAGATTC TGCTCCAGAC CATCACCAGA TGACGACGTT GATAAGATGA
ATCGTTTCGT CTCGTTTACG AGATCATACG AGTAGATAGT GCGAATTCCG CGGTAAAAAT GGTTTGGTTT AGATCTCAGT
GATTTTTGGG TGTCGCCTTT GATGTAGCTG TAATTGTTAg agcatataca atagcaggct ataagtccgt tataaacata
agtccgttat aaacatattt taaagagata tatgaaaaga taggagagca gcgggctaca gatctgtagc cagctgcagc
atgggaattg gct