Os06t0264200-01

Locus

Os06g0264200

Description

CONSTANS-like protein, Transcription factor, Repression of flowering, Regulation of plant height and grain yield

RAP-DB Gene Symbol Synonym(s)

OsCOL16

RAP-DB Gene Name Synonym(s)

CONSTANS-like protein 16

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBX17, BBX17, OsL, OsCCT20, CCT20, OsCOL16, COL16

Oryzabase Gene Name Synonym(s)

B-box-containing protein 17, CCT domain-containing gene 20, CCT (CO, CO-LIKE and TOC1) domain protein 20, CCT domain protein 20, CONSTANS-like protein 16

Transcript Evidence

Inferred from literature

Protein Evidence

A3BAG5

Literature

PMID: 28554475

Note

Manual Curation

June 26, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

B-box-type zinc finger (IPR000315)

CCT domain (IPR010402)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os06t0264200-00)

Others

Oryzabase (11648)

KEGG (Os06t0264200-00)

Transcript

2020 bp

>Os06t0264200-01 CONSTANS-like protein, Transcription factor, Repression of flowering, Regulation of plant height and grain yield
GTGTTCGTCCAGCCGCGACACGACACGACACGGGGACTGAAGGAGGAAGAAGAAGAGGAG
TGGTAGATGAGCAGCACGGCGAAGGCGGCGGCCGCCGGGGCGGTGGGTGCCAAGTCGGCG
CGGGCGTGCGACGGCTGCCTGCGCCGGCGGGCGAGGTGGTACTGCGCGGCGGACGACGCG
TTCCTGTGCCAGGGGTGCGACACGTCGGTGCACTCCGCGAACCCGCTCGCGCGGCGCCAC
GAGCGGCTGCGGCTGCGGCCGTCGTCGCCGCCGCCGCTGGTGCCGCCGTCGGGGTCGGGG
CGGCGCGACGAGGCCGTCCCCGCGGCGTGGTTCAAGCGCAAGGCGCGGACCCCGCGGTCG
CACGCCGCCAAGAGCGCCGCCGCCTTCGGGCAGCTGCTGTCGAGGCGGCTCGTCGTCGTT
CCCGAGGCGGCGGCTGGTAGTGGAGGGGACTCGCCGGAGGAGCGGAAGGACGAGGGGGAG
ATCGTGGAGGAGCAGGAGCAGCTGCTGTACCGCGTCCCCATCTTTGACCCGGCCCTCTCG
GAGTTCTGCTCGCCGCCTCCCCTCGAGGACGCGGCGGCCGCCGTGTCCTGCTGCAATGAG
GACGGCGCCGTCGAGAACCCGACGAAGCCGTCCATGACGACGACGACGGCTACAACGCCA
CCGCTCCAGTTCTTCCCCGACGGCCAAGCCAATTTCGGGCCGACCGACGCCGAGCTGAGG
GAGTTCGCCGCCGACATGGAGGCCCTCCTCGGGCGTGGCCTGGACGACGGCAACGACGAG
GACTCCTTCTGCATGGAGACGCTGGGGCTCATCGAGCCGGTGGACGACGACGCCGGGCGG
GTCAAGGTGGAGGCCGACGGCGACGCCGGGATGACCCTAGCGTGGTGCCACGAGCTGGAC
ACGGAGACATCGTCCGGCGAGATGCTGGACATCGACTTCGACTGCGGCTCACCTCAGGCG
GCGACGACACCCGACGAGAAGGTCGGGAGCAGCGGGCCCGCCGCCGCCGACGACGACGCG
CAGCTCCAGCAGAGCAACCTCGCCCTCAGCCTCAACTACGAGGCCATCATCGAGAGCTGG
GGGACCTCGCCGTGGACCGACGGCGAGCGGCCGCACGTCAAGCTCGACGACTCCTGGCCC
CGCGATTACTCGGGGGTGTGGATGGCGGCGGCAGGGGTGTTCGGGCACGGCGGCGAGGAG
CAGGCGCTGACGCCGAGGCTGGGGATGGACGGCGGCAGGGAGGCGCGGGTGTCGAGGTAC
AGGGAGAAGCGGCGGACGCGGCTCTTCTCCAAGAAGATCCGGTACGAGGTGCGCAAGCTC
AACGCCGAGAAGCGGCCGCGGATGAAGGGCCGCTTCGTCAAGCGCGCCGCCGCCGCCGCC
ACCGCCGCCGTCGCCACGGCGTGCGTCGCGTAGCGCTGCATGGCGGAAGTTTGATCTGCC
GGCCGCGCGCTCGCCATGAAATCACACAAGAACAAAACAACTCGTCGAAACTGCATTAGT
TTTAGCTGGTTTCTTTTACGGTCACACATGCGTCTTCTTTTTCCATCAGTTCACCATTGA
TGGTTGCTAAGGATCCAAGGACTTTTAATAATAATTATTACTATAATAATAATGATAATA
CTAAAAAGTGAATTGTACTATTTGTTGAGAGGTATACAGTACCCCTGCGCTCAATTGCTG
AAAGTTTTGAAAGTTTTTTTCCTCCCTTCAGATTCAGGGGGTTGGTTGACAGTAGTAGCC
TGTAGCTGTGCTGTATGCATATATGTCCATTGGTTGTCCTGCACGGGTACAGTTCGAGGC
CAGGAGATATACATGTAAATCAATCAATCAATATATACAACTAATTGATTCAGTGATGAC
CTCATATGTTTGTTGAGTTGAATAGAAGTTCTTTCACTTTCTCCCAACTTTAAATTTTGA
AAGGGGGATAAATTATTGTATGTATTCAGGATTGCAAAATACAAACTTTATTGGTAATCA
GTTTTTGCTGAGGTATTTGTTCGAATAAAGTTATGGAATT

CDS

1347 bp

>Os06t0264200-01 CONSTANS-like protein, Transcription factor, Repression of flowering, Regulation of plant height and grain yield
ATGAGCAGCACGGCGAAGGCGGCGGCCGCCGGGGCGGTGGGTGCCAAGTCGGCGCGGGCG
TGCGACGGCTGCCTGCGCCGGCGGGCGAGGTGGTACTGCGCGGCGGACGACGCGTTCCTG
TGCCAGGGGTGCGACACGTCGGTGCACTCCGCGAACCCGCTCGCGCGGCGCCACGAGCGG
CTGCGGCTGCGGCCGTCGTCGCCGCCGCCGCTGGTGCCGCCGTCGGGGTCGGGGCGGCGC
GACGAGGCCGTCCCCGCGGCGTGGTTCAAGCGCAAGGCGCGGACCCCGCGGTCGCACGCC
GCCAAGAGCGCCGCCGCCTTCGGGCAGCTGCTGTCGAGGCGGCTCGTCGTCGTTCCCGAG
GCGGCGGCTGGTAGTGGAGGGGACTCGCCGGAGGAGCGGAAGGACGAGGGGGAGATCGTG
GAGGAGCAGGAGCAGCTGCTGTACCGCGTCCCCATCTTTGACCCGGCCCTCTCGGAGTTC
TGCTCGCCGCCTCCCCTCGAGGACGCGGCGGCCGCCGTGTCCTGCTGCAATGAGGACGGC
GCCGTCGAGAACCCGACGAAGCCGTCCATGACGACGACGACGGCTACAACGCCACCGCTC
CAGTTCTTCCCCGACGGCCAAGCCAATTTCGGGCCGACCGACGCCGAGCTGAGGGAGTTC
GCCGCCGACATGGAGGCCCTCCTCGGGCGTGGCCTGGACGACGGCAACGACGAGGACTCC
TTCTGCATGGAGACGCTGGGGCTCATCGAGCCGGTGGACGACGACGCCGGGCGGGTCAAG
GTGGAGGCCGACGGCGACGCCGGGATGACCCTAGCGTGGTGCCACGAGCTGGACACGGAG
ACATCGTCCGGCGAGATGCTGGACATCGACTTCGACTGCGGCTCACCTCAGGCGGCGACG
ACACCCGACGAGAAGGTCGGGAGCAGCGGGCCCGCCGCCGCCGACGACGACGCGCAGCTC
CAGCAGAGCAACCTCGCCCTCAGCCTCAACTACGAGGCCATCATCGAGAGCTGGGGGACC
TCGCCGTGGACCGACGGCGAGCGGCCGCACGTCAAGCTCGACGACTCCTGGCCCCGCGAT
TACTCGGGGGTGTGGATGGCGGCGGCAGGGGTGTTCGGGCACGGCGGCGAGGAGCAGGCG
CTGACGCCGAGGCTGGGGATGGACGGCGGCAGGGAGGCGCGGGTGTCGAGGTACAGGGAG
AAGCGGCGGACGCGGCTCTTCTCCAAGAAGATCCGGTACGAGGTGCGCAAGCTCAACGCC
GAGAAGCGGCCGCGGATGAAGGGCCGCTTCGTCAAGCGCGCCGCCGCCGCCGCCACCGCC
GCCGTCGCCACGGCGTGCGTCGCGTAG

Protein

449 aa

>Os06t0264200-01 CONSTANS-like protein, Transcription factor, Repression of flowering, Regulation of plant height and grain yield
MSSTAKAAAAGAVGAKSARACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHER
LRLRPSSPPPLVPPSGSGRRDEAVPAAWFKRKARTPRSHAAKSAAAFGQLLSRRLVVVPE
AAAGSGGDSPEERKDEGEIVEEQEQLLYRVPIFDPALSEFCSPPPLEDAAAAVSCCNEDG
AVENPTKPSMTTTTATTPPLQFFPDGQANFGPTDAELREFAADMEALLGRGLDDGNDEDS
FCMETLGLIEPVDDDAGRVKVEADGDAGMTLAWCHELDTETSSGEMLDIDFDCGSPQAAT
TPDEKVGSSGPAAADDDAQLQQSNLALSLNYEAIIESWGTSPWTDGERPHVKLDDSWPRD
YSGVWMAAAGVFGHGGEEQALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNA
EKRPRMKGRFVKRAAAAATAAVATACVA*

5'UTR

chr06:8704831..8704896 (+ strand) : 66 bp

CDS

chr06:8704897..8705982 (+ strand) : 1086 bp

chr06:8706082..8706342 (+ strand) : 261 bp

3'UTR

chr06:8706343..8706949 (+ strand) : 607 bp

FASTA

>Os06t0264200-01 class=Sequence position=chr06:8704831..8706949 (+ strand)
GTGTTCGTCC AGCCGCGACA CGACACGACA CGGGGACTGA AGGAGGAAGA AGAAGAGGAG TGGTAGATGA GCAGCACGGC
GAAGGCGGCG GCCGCCGGGG CGGTGGGTGC CAAGTCGGCG CGGGCGTGCG ACGGCTGCCT GCGCCGGCGG GCGAGGTGGT
ACTGCGCGGC GGACGACGCG TTCCTGTGCC AGGGGTGCGA CACGTCGGTG CACTCCGCGA ACCCGCTCGC GCGGCGCCAC
GAGCGGCTGC GGCTGCGGCC GTCGTCGCCG CCGCCGCTGG TGCCGCCGTC GGGGTCGGGG CGGCGCGACG AGGCCGTCCC
CGCGGCGTGG TTCAAGCGCA AGGCGCGGAC CCCGCGGTCG CACGCCGCCA AGAGCGCCGC CGCCTTCGGG CAGCTGCTGT
CGAGGCGGCT CGTCGTCGTT CCCGAGGCGG CGGCTGGTAG TGGAGGGGAC TCGCCGGAGG AGCGGAAGGA CGAGGGGGAG
ATCGTGGAGG AGCAGGAGCA GCTGCTGTAC CGCGTCCCCA TCTTTGACCC GGCCCTCTCG GAGTTCTGCT CGCCGCCTCC
CCTCGAGGAC GCGGCGGCCG CCGTGTCCTG CTGCAATGAG GACGGCGCCG TCGAGAACCC GACGAAGCCG TCCATGACGA
CGACGACGGC TACAACGCCA CCGCTCCAGT TCTTCCCCGA CGGCCAAGCC AATTTCGGGC CGACCGACGC CGAGCTGAGG
GAGTTCGCCG CCGACATGGA GGCCCTCCTC GGGCGTGGCC TGGACGACGG CAACGACGAG GACTCCTTCT GCATGGAGAC
GCTGGGGCTC ATCGAGCCGG TGGACGACGA CGCCGGGCGG GTCAAGGTGG AGGCCGACGG CGACGCCGGG ATGACCCTAG
CGTGGTGCCA CGAGCTGGAC ACGGAGACAT CGTCCGGCGA GATGCTGGAC ATCGACTTCG ACTGCGGCTC ACCTCAGGCG
GCGACGACAC CCGACGAGAA GGTCGGGAGC AGCGGGCCCG CCGCCGCCGA CGACGACGCG CAGCTCCAGC AGAGCAACCT
CGCCCTCAGC CTCAACTACG AGGCCATCAT CGAGAGCTGG GGGACCTCGC CGTGGACCGA CGGCGAGCGG CCGCACGTCA
AGCTCGACGA CTCCTGGCCC CGCGATTACT CGGTACGTGC CACGCCATGC ACACCGTACG CCTCGTCTCA CCGTATACTC
CACAATTTAG CTGGTACTGA TGACTTGCTC CGGCGACGTG CGGCGGTGCA GGGGGTGTGG ATGGCGGCGG CAGGGGTGTT
CGGGCACGGC GGCGAGGAGC AGGCGCTGAC GCCGAGGCTG GGGATGGACG GCGGCAGGGA GGCGCGGGTG TCGAGGTACA
GGGAGAAGCG GCGGACGCGG CTCTTCTCCA AGAAGATCCG GTACGAGGTG CGCAAGCTCA ACGCCGAGAA GCGGCCGCGG
ATGAAGGGCC GCTTCGTCAA GCGCGCCGCC GCCGCCGCCA CCGCCGCCGT CGCCACGGCG TGCGTCGCGT AGCGCTGCAT
GGCGGAAGTT TGATCTGCCG GCCGCGCGCT CGCCATGAAA TCACACAAGA ACAAAACAAC TCGTCGAAAC TGCATTAGTT
TTAGCTGGTT TCTTTTACGG TCACACATGC GTCTTCTTTT TCCATCAGTT CACCATTGAT GGTTGCTAAG GATCCAAGGA
CTTTTAATAA TAATTATTAC TATAATAATA ATGATAATAC TAAAAAGTGA ATTGTACTAT TTGTTGAGAG GTATACAGTA
CCCCTGCGCT CAATTGCTGA AAGTTTTGAA AGTTTTTTTC CTCCCTTCAG ATTCAGGGGG TTGGTTGACA GTAGTAGCCT
GTAGCTGTGC TGTATGCATA TATGTCCATT GGTTGTCCTG CACGGGTACA GTTCGAGGCC AGGAGATATA CATGTAAATC
AATCAATCAA TATATACAAC TAATTGATTC AGTGATGACC TCATATGTTT GTTGAGTTGA ATAGAAGTTC TTTCACTTTC
TCCCAACTTT AAATTTTGAA AGGGGGATAA ATTATTGTAT GTATTCAGGA TTGCAAAATA CAAACTTTAT TGGTAATCAG
TTTTTGCTGA GGTATTTGTT CGAATAAAGT TATGGAATT

Locus: Os06g0264200

Loading...

Locus: Os06g0264200

Loading...