Os06t0265000-01

Locus

Os06g0265000

Description

Asparagine synthetase, Long-distance transport of asparagine

RAP-DB Gene Symbol Synonym(s)

ASN, OsASN2, OsAS, OsAS2, AS2

RAP-DB Gene Name Synonym(s)

ASPARAGINE SYNTHETASE, asparagine synthetase 2, Asparagine Synthetase2

CGSNL Gene Symbol

ASN

CGSNL Gene Name

ASPARAGINE SYNTHETASE

Oryzabase Gene Symbol Synonym(s)

OsASN2, OsAS, OsAS2, AS2

Oryzabase Gene Name Synonym(s)

asparagine synthetase 2, Asparagine Synthetase2

Transcript Evidence

AK100247

D83378

U55873

Protein Evidence

Q43011

Literature

PMID: 25634963

Note

Manual Curation

September 4, 2015

Gene Ontology (GO)

Biological Process: asparagine biosynthetic process (GO:0006529)

Molecular Function: asparagine synthase (glutamine-hydrolyzing) activity (GO:0004066)

Functional domain (InterPro)

Asparagine synthase, glutamine-hydrolyzing (IPR006426)

Nucleophile aminohydrolases, N-terminal (IPR029055)

Glutamine amidotransferase type 2 domain (IPR017932)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Asparagine synthase (IPR001962)

Full-length cDNA

J023058E10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0265000-01)

RiceXPro (AK100247)

Others

Oryzabase (9307)

KEGG (Os06t0265000-01 (EC:6.3.5.4))

Transcript

2264 bp

>Os06t0265000-01 Asparagine synthetase, Long-distance transport of asparagine
GCGGATTCCATTCTCCTCTTGGCATCACGAGGCGGCGCCGCTTGGTCTAGCTAGTAGCCA
CAGGGAGAGGTGGTAGCCGCAGCCGCCGCCGACGAGACCTCGCCGCCGGGGGGAGGGCAC
CATGTGTGGCATCCTCGCCGTGCTCGGCGTCGCAGACGTCTCCCTCGCCAAGCGCTCCCG
CATCATCGAGCTATCCCGCCGGTTACGTCATAGAGGCCCTGATTGGAGTGGTATACACTG
CTATCAGGATTGCTATCTTGCACACCAGCGGTTGGCTATTGTTGATCCCACATCCGGAGA
CCAGCCGTTGTACAATGAGGACAAATCTGTTGTTGTGACGGTGAATGGAGAGATCTATAA
CCATGAAGAATTGAAAGCTAACCTGAAATCTCATAAATTCCAAACTGCTAGCGATTGTGA
AGTTATTGCTCATCTGTATGAGGAATATGGGGAGGAATTTGTGGATATGTTGGATGGGAT
GTTCGCTTTTGTTCTTCTTGACACACGTGATAAAAGCTTCATTGCAGCCCGTGATGCTAT
TGGCATTTGTCCTTTATACATGGGCTGGGGTCTTGATGGTTCGGTTTGGTTTTCGTCAGA
GATGAAGGCATTAAGTGATGATTGCGAGCGATTCATATCCTTCCCCCCTGGGCACTTGTA
CTCCAGCAAAACAGGTGGCCTAAGGAGATGGTACAACCCACCATGGTTTTCTGAAAGCAT
TCCCTCCACCCCGTACAATCCTCTTCTTCTCCGACAGAGCTTTGAGAAGGCTATTATTAA
GAGGCTAATGACAGATGTGCCATTTGGTGTTCTCTTGTCTGGTGGACTGGACTCTTCTTT
GGTTGCATCTGTTGTTTCGCGGCACTTGGCAGAGGCAAAAGTTGCCGCACAGTGGGGAAA
CAAACTGCATACATTTTGCATTGGTTTGAAAGGTTCTCCTGATCTTAGAGCTGCTAAGGA
AGTTGCAGACTACCTTGGTACTGTTCATCACGAACTCCACTTCACAGTGCAGGAAGGCAT
TGATGCACTGGAGGAAGTCATTTACCATGTTGAGACATATGATGTAACGACAATTAGAGC
AAGCACCCCAATGTTCTTGATGTCACGTAAAATTAAATCTTTGGGGGTGAAGATGGTTCT
TTCGGGAGAAGGTTCTGATGAAATATTTGGCGGTTACCTTTATTTTCACAAGGCACCAAA
CAAGAAGGAATTCCATGAGGAAACATGTCGGAAGATAAAAGCCCTTCATTTATATGATTG
CTTGAGAGCGAACAAATCAACTTCTGCATGGGGTGTTGAGGCCCGTGTTCCGTTCCTTGA
CAAAAACTTCATCAATGTAGCTATGGACATTGATCCTGAATGGAAAATGATAAAACGTGA
TCTTGGCCGTATTGAGAAATGGGTTCTCCGGAATGCATTTGATGATGAGGAGAAGCCCTA
TTTACCTAAGCACATTCTATACAGGCAAAAGGAGCAATTCAGTGATGGTGTTGGGTACAG
TTGGATTGATGGATTGAAGGATCATGCAAATGAACATGTATCAGATTCCATGATGATGAA
CGCTAGCTTTGTTTACCCAGAAAACACTCCAGTTACAAAAGAAGCGTACTATTATAGGAC
AATATTCGAGAAATTCTTTCCCAAGAATGCTGCTAGGTTGACAGTACCTGGAGGTCCTAG
CGTCGCGTGCAGCACTGCTAAAGCTGTTGAATGGGACGCAGCCTGGTCCAAAAACCTTGA
TCCATCTGGTCGTGCTGCTCTTGGTGTTCATGATGCTGCATATGAAGATACTCTACAAAA
ATCTCCTGCCTCTGCCAATCCTGTCTTGGATAACGGCTTTGGTCCAGCCCTTGGGGAAAG
CATGGTCAAAACCGTTGCTTCAGCCACTGCCGTTTAACTTTCTATCGTCGCATAAAACTC
CGTAGTTTGTTGTTCTTGGTTCAATCCCAGCTTCTTTCAGATGTCGTTAGTTTCTTCAAA
CATGTAATGGAGATGCGTGCTTTTCCTGGCTTGTTAGTTACTGTATGCTTGTCATCGTGT
ATGTTTTCTTTTCTTTTCCAATATGCAAACTGTTTGGTCGTGGACTGATCAGAACATTGT
AAATATGAATAACCGCGACTGATATCCTCAAGTTGCTTTTGGTTTGCAATAGTTCTAATC
TTGATGTTCTGCTGGGAATCGGAAGATGTTATGCAGTATGCGTATTGTTGGGGTGTAACC
GTGTAAGTGCATCTGAAATGAAGTTACGGGCGATGGTAACTGGG

CDS

1776 bp

>Os06t0265000-01 Asparagine synthetase, Long-distance transport of asparagine
ATGTGTGGCATCCTCGCCGTGCTCGGCGTCGCAGACGTCTCCCTCGCCAAGCGCTCCCGC
ATCATCGAGCTATCCCGCCGGTTACGTCATAGAGGCCCTGATTGGAGTGGTATACACTGC
TATCAGGATTGCTATCTTGCACACCAGCGGTTGGCTATTGTTGATCCCACATCCGGAGAC
CAGCCGTTGTACAATGAGGACAAATCTGTTGTTGTGACGGTGAATGGAGAGATCTATAAC
CATGAAGAATTGAAAGCTAACCTGAAATCTCATAAATTCCAAACTGCTAGCGATTGTGAA
GTTATTGCTCATCTGTATGAGGAATATGGGGAGGAATTTGTGGATATGTTGGATGGGATG
TTCGCTTTTGTTCTTCTTGACACACGTGATAAAAGCTTCATTGCAGCCCGTGATGCTATT
GGCATTTGTCCTTTATACATGGGCTGGGGTCTTGATGGTTCGGTTTGGTTTTCGTCAGAG
ATGAAGGCATTAAGTGATGATTGCGAGCGATTCATATCCTTCCCCCCTGGGCACTTGTAC
TCCAGCAAAACAGGTGGCCTAAGGAGATGGTACAACCCACCATGGTTTTCTGAAAGCATT
CCCTCCACCCCGTACAATCCTCTTCTTCTCCGACAGAGCTTTGAGAAGGCTATTATTAAG
AGGCTAATGACAGATGTGCCATTTGGTGTTCTCTTGTCTGGTGGACTGGACTCTTCTTTG
GTTGCATCTGTTGTTTCGCGGCACTTGGCAGAGGCAAAAGTTGCCGCACAGTGGGGAAAC
AAACTGCATACATTTTGCATTGGTTTGAAAGGTTCTCCTGATCTTAGAGCTGCTAAGGAA
GTTGCAGACTACCTTGGTACTGTTCATCACGAACTCCACTTCACAGTGCAGGAAGGCATT
GATGCACTGGAGGAAGTCATTTACCATGTTGAGACATATGATGTAACGACAATTAGAGCA
AGCACCCCAATGTTCTTGATGTCACGTAAAATTAAATCTTTGGGGGTGAAGATGGTTCTT
TCGGGAGAAGGTTCTGATGAAATATTTGGCGGTTACCTTTATTTTCACAAGGCACCAAAC
AAGAAGGAATTCCATGAGGAAACATGTCGGAAGATAAAAGCCCTTCATTTATATGATTGC
TTGAGAGCGAACAAATCAACTTCTGCATGGGGTGTTGAGGCCCGTGTTCCGTTCCTTGAC
AAAAACTTCATCAATGTAGCTATGGACATTGATCCTGAATGGAAAATGATAAAACGTGAT
CTTGGCCGTATTGAGAAATGGGTTCTCCGGAATGCATTTGATGATGAGGAGAAGCCCTAT
TTACCTAAGCACATTCTATACAGGCAAAAGGAGCAATTCAGTGATGGTGTTGGGTACAGT
TGGATTGATGGATTGAAGGATCATGCAAATGAACATGTATCAGATTCCATGATGATGAAC
GCTAGCTTTGTTTACCCAGAAAACACTCCAGTTACAAAAGAAGCGTACTATTATAGGACA
ATATTCGAGAAATTCTTTCCCAAGAATGCTGCTAGGTTGACAGTACCTGGAGGTCCTAGC
GTCGCGTGCAGCACTGCTAAAGCTGTTGAATGGGACGCAGCCTGGTCCAAAAACCTTGAT
CCATCTGGTCGTGCTGCTCTTGGTGTTCATGATGCTGCATATGAAGATACTCTACAAAAA
TCTCCTGCCTCTGCCAATCCTGTCTTGGATAACGGCTTTGGTCCAGCCCTTGGGGAAAGC
ATGGTCAAAACCGTTGCTTCAGCCACTGCCGTTTAA

Protein

592 aa

>Os06t0265000-01 Asparagine synthetase, Long-distance transport of asparagine
MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD
QPLYNEDKSVVVTVNGEIYNHEELKANLKSHKFQTASDCEVIAHLYEEYGEEFVDMLDGM
FAFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFISFPPGHLY
SSKTGGLRRWYNPPWFSESIPSTPYNPLLLRQSFEKAIIKRLMTDVPFGVLLSGGLDSSL
VASVVSRHLAEAKVAAQWGNKLHTFCIGLKGSPDLRAAKEVADYLGTVHHELHFTVQEGI
DALEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKSTSAWGVEARVPFLDKNFINVAMDIDPEWKMIKRD
LGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANEHVSDSMMMN
ASFVYPENTPVTKEAYYYRTIFEKFFPKNAARLTVPGGPSVACSTAKAVEWDAAWSKNLD
PSGRAALGVHDAAYEDTLQKSPASANPVLDNGFGPALGESMVKTVASATAV*

5'UTR

chr06:8765560..8765680 (- strand) : 121 bp

CDS

chr06:8765480..8765559 (- strand) : 80 bp

chr06:8764170..8764308 (- strand) : 139 bp

chr06:8763775..8763870 (- strand) : 96 bp

chr06:8763516..8763657 (- strand) : 142 bp

chr06:8761871..8761966 (- strand) : 96 bp

chr06:8761590..8761686 (- strand) : 97 bp

chr06:8761137..8761296 (- strand) : 160 bp

chr06:8760859..8760939 (- strand) : 81 bp

chr06:8760546..8760767 (- strand) : 222 bp

chr06:8760226..8760360 (- strand) : 135 bp

chr06:8760049..8760129 (- strand) : 81 bp

chr06:8759867..8759953 (- strand) : 87 bp

chr06:8759637..8759744 (- strand) : 108 bp

chr06:8759303..8759554 (- strand) : 252 bp

3'UTR

chr06:8758936..8759302 (- strand) : 367 bp

FASTA

>Os06t0265000-01 class=Sequence position=chr06:8758936..8765680 (- strand)
GCGGATTCCA TTCTCCTCTT GGCATCACGA GGCGGCGCCG CTTGGTCTAG CTAGTAGCCA CAGGGAGAGG TGGTAGCCGC
AGCCGCCGCC GACGAGACCT CGCCGCCGGG GGGAGGGCAC CATGTGTGGC ATCCTCGCCG TGCTCGGCGT CGCAGACGTC
TCCCTCGCCA AGCGCTCCCG CATCATCGAG CTATCCCGCC GGTAGCATGC CGCCCTCGTC CCCTTCCCCT CTCTCTCTCT
TTCTCTCTCT CTGTCTCTCG CTGTATATCT GGTCCGCGCA CGTTCGTGTG TTCGTTCTGA ATCGAGGGAT GGAGATTTTG
GCCGTGGATC TGGAAGGGTT GGACTCGTCG CCGCCGTGAG ATGGTTGTGC TCTAGGTGGC GTCCTGTTTA TTCGACTATC
AAATAGCTCC GTTAAAATAG TTCGTCGGAA TTTTGATGAT TCAACGTGGT CGAAAAGTTC GTCGGAATGT TTGGGGGGGG
GGGGGGGTAA ATCCAACGTT GTTTTTGTTT TTGGTTATCA ATATGGGAGC GAGCTGTGGT GCATCATTAA TGACGGGTTG
TTCGATGGAT GGTGACTTTA CTGGTTAGGA GTGTTTATGT CGTGTAAGCT TGTAAAGAGA TAAGAATATA GATGGATTAT
GGAAATGGAG ACATGGAGTT CTATGTAGTG TAGCTACCGT TTTGGTGAGT CTAATTCCTC AGAGTTTTCA TTCGGAAATG
ATAACGTATC AACAAGTTTT ATTTGCACGA GATGCCTCTG GCGTGTGCTC TTGCATGGTA ATGCCGTTAA ATGATGTTGA
TTCCAATTTG ATTAAAATGT AGTATTATAT ACGTCAACTG TAACATGTAA CACATGCCTC CGTGATGTGC CCCTTGTGCT
TGCTGTGACA AGTACGGGGT TCTGATTTAA AATTACGACA ATGGCGATAT AATGGGCTTA ATAATCTGTA AAATACGGTC
AGCTTTGTTT TGCCTGGAAT TCTATTGTTG TGGGAAGTGT GGGCCTGCTA ACTCAGAGTT ATGCTATGGA TTGCCAATAT
GTAGAAAATG CATCTTTCTA TTCTACTGTA GTATAATGTG GCATGTTTTT ATCACTGTAG TCTGCACTCT GCAACCACTT
GATCTTTAGG AACTGAATGG TTACAGTTTC TTGTGTATGT CCTTATATTA GAGCAAATAA TTTTCAACGT AGATTTAATA
AATCTTCTGA TAGAATTAGT ACCAACTTGT TGTAGACTCA AGGCATGCTG CATTTTTCAT AGGTTGTTGT GACGGTATGT
AATTCATAGT TTTCATAGAT TTAATAAATC TTCTGATAGA ATTTTTTGAA CTGCTTATGC ACTGACTAAC CCAAGTTTTC
CAATTTTCAT AGGTTACGTC ATAGAGGCCC TGATTGGAGT GGTATACACT GCTATCAGGA TTGCTATCTT GCACACCAGC
GGTTGGCTAT TGTTGATCCC ACATCCGGAG ACCAGCCGTT GTACAATGAG GACAAATCTG TTGTTGTGAC GGTATGTACC
TTGACTGTTC CATTGACCCT TATGCACCCT CCGCAGATTT TTTTTTTAGT ATTTCATTAA CTTTTAAGTT TTAATATGTG
ATTTGCCTCG CTATTCTACT TTTGGTAAAT AGCATGTTTC TGAAATATTT TGTCATGGGA CTTTCCAAAT ATGTCCCTTG
AGCTCTTTGC ATCTTATAAC GGTACAATAT TTTAATCATC AAAATGTCTT GTAATGAAAT AAATCAAAGA TTTCTTTCCT
TATTATAGTT TCTGTGGAAC CACATCTGAT CTTGTAGTTG ACACATCCAG GTGAATGGAG AGATCTATAA CCATGAAGAA
TTGAAAGCTA ACCTGAAATC TCATAAATTC CAAACTGCTA GCGATTGTGA AGTTATTGCT CATCTGGTAA GTTACATGTT
CTCTTTGTTG CACCTTGTTA TTGCTCAAAT TTCATCTAAG CATCGCCTGG TATACACTTA CTATTCCTTC GTATTGACAC
TTTCATATTG ATCTTTTTCA CAGTATGAGG AATATGGGGA GGAATTTGTG GATATGTTGG ATGGGATGTT CGCTTTTGTT
CTTCTTGACA CACGTGATAA AAGCTTCATT GCAGCCCGTG ATGCTATTGG CATTTGTCCT TTATACATGG GCTGGGGTCT
TGATGGTATG TGCACTCCTG CAGTGAATCT GTTCACCACT TCATCTAGTT ATTGATCCTT GTGCTGGAAA CCAGGAGGTT
TGATTCCTTA TTTTTCTACA AAAAATTGTG GTGGTCACAA TTTTCCATTG GTTTGTTTGG TTATACCACT GTTTCAGTGG
CTAGTCAGTG CTTCAAGGCT AGGGTTCACA TTGATTCTTG CTGGAACCAT TTTTCTCTGT TTGATCAATG AGGAGAAAAA
ACAGTGCCGG ATCATTTACC ATCAATTGCC TATTGTGTTG CAAATTAAAT TAAAATGGAA AGGACCAAAC AAAATTTGCA
AACAACCTGG CATATGCATA GTTTTAGCAC AGGATAATTT GGAACTGTAA CCGTCTGTCC GTGTGGATTG CATCACTTCG
AGTGAGTCTG AGAAAATGAA TAATTTGTGG CATTCAGTAT TTCTTGCAAT TTTCAATATA TCTGTTGGGA ATGTTGTTGA
TTGATATTCT GTATATGTGC AAGCATTTAC ATTTTGAAAA GTTAAATGTG ATAGTCAGTT GATGGAAATC TTGATACTTG
CTATTCAACA AGCAATCGCC AGCTCTCTCT TACTTATGTT GTTGACGGTC ATAGGCTTTA AGCCTACTTT ATGCGTGTAA
GAAAGAAATT AAATTGTTTG GCATGTCCTA ATCTCTTGGA CTGTCAGATA AAtataagat actccctccg tcccataata
taagggattt tgagttttgc ttgtaatatt tgaccattcg tcttattcaa aaaattttga aattattaat tattttattt
gtgacttact ttattatcta cagtatttta agcacaactt tttgttttta atatttgcaa aaaaaatttg aataagacga
gtggtcaaac gttgcaagca aaaactgaaa atcccttata ttgtgggacg gagggagtaG TTCACTTAAT AGTTACCTAT
TTTCTTGACA AGGTTATCAA ATCTGCCCTT TTAGCTTGCA AATAGAACTA TAGAGATCCT GGTTTGATGC CTGTTGCTTC
AAAGAACATT AAGGTTTTTG CTACTCACCA TGATGGAACA TTATTCCTTT TGGATCCGAA TATCTGATAT TGGGACCCTT
CAAGACTTTT GTTGCCCAAG CCCATAAAAA CACAAAACAA GGGCAATATA ATATGTTTGA AGATGCACTT TTTTTCTTTG
GTATGTTTGG TTACCAAATC TCCACGTTTA GTTTGCAGGA TAAAAATTCT GGTTTTGATA TATGTTCCTT CTAAGAAATT
TAAGGTTTTC GTCACTGGTC ATGAAGTAGG ATTCTTTTTC GATGTAATAT CAGGGTCCTT GTTCAAGGTC TTTGTTGCCC
AAGCTCATAA TACAGAATGA CAATATAATA TACTTGCAGA GGGCAAGAGG CACCGTTTCC TTCCATATGT CTGGAAATAT
AATTTCTCCT TGTCTTCGAA TCTTGGCTAG TGCGATGTTA GTTTAGCATT ATTGCCTTTG TGATTTTTAT TAGGGTATAC
TTGGTGTTTA TTTGTAGGTG TATTGTGTTT TCAGGTTCGG TTTGGTTTTC GTCAGAGATG AAGGCATTAA GTGATGATTG
CGAGCGATTC ATATCCTTCC CCCCTGGGCA CTTGTACTCC AGCAAAACAG GTGTGCTATT TCGCATTTGT GACATACTGA
CAGTATCGTC TAACAGTTGA TGTTAGAAAC ACTGTTTTTA GGCCCAGAAG ACGAAAAAAA GAGGAAGGCA GAAATGATCA
AAactattat aatattgcaa atatcatttt gttttgtcta tgattactga cttgtcTTCT AATATCCAAC CTAGGTGGCC
TAAGGAGATG GTACAACCCA CCATGGTTTT CTGAAAGCAT TCCCTCCACC CCGTACAATC CTCTTCTTCT CCGACAGAGC
TTTGAGAAGG CACGTCCCAT TCCCATATCT CTTACGCTGC ACAAAATCTC TTCTAAACTT TTGATATGTT GTGTTTATGC
CGCTGATTAG GAAAAGCTTG TTCAAACCTC AGATGGTTTT TCATACAATA GATTATTTTA GCATGATATA TTATACTGCT
CTCAGATTGA CCAATGATGG TTCACCATGT TGACCTCTGT ATTAATATTC AAATAGATGG CATAACATTT CTGAATGGTC
TATGCATGTT TATGGTAGCA TAAGCAAATG ATTATATCTT ACATAAGATG CAAATTCTGC AGGCTATTAT TAAGAGGCTA
ATGACAGATG TGCCATTTGG TGTTCTCTTG TCTGGTGGAC TGGACTCTTC TTTGGTTGCA TCTGTTGTTT CGCGGCACTT
GGCAGAGGCA AAAGTTGCCG CACAGTGGGG AAACAAACTG CATACATTTT GCATTGGTTT GAAAGTAAGT TTCTTAAGCA
TTGAGTCCTA TTATTGCGAA GATTTGTGTT AGCCTGTAGG GTATCTTTCC AATTTTTACC TGTTCTCCTG GTGTTCTGAG
TATTTTGAAA GAAAATGGAT TTTTTTTTAA AAAAAAGGAG TGATATGCTT AGATATTGGG CACATGATGA TCTAGTTCTT
CAATGTTCCC CTTTTTTGTA GGGTTCTCCT GATCTTAGAG CTGCTAAGGA AGTTGCAGAC TACCTTGGTA CTGTTCATCA
CGAACTCCAC TTCACAGTGC AGGTTCTGTA TCTGTTCTCT GTTTTTTTTG CATAGTGAGA AAAAAAATCT TTTGAAGCTC
TGATTCAATA TTGTAAAAAA AAAATGAAAA CAGGAAGGCA TTGATGCACT GGAGGAAGTC ATTTACCATG TTGAGACATA
TGATGTAACG ACAATTAGAG CAAGCACCCC AATGTTCTTG ATGTCACGTA AAATTAAATC TTTGGGGGTG AAGATGGTTC
TTTCGGGAGA AGGTTCTGAT GAAATATTTG GCGGTTACCT TTATTTTCAC AAGGCACCAA ACAAGAAGGA ATTCCATGAG
GAAACATGTC GGAAGGTAAT TAAGGAGAAT ATTTTCATGA TTAATCTTCT TCTGCCCAAG GCAGCTAAAT GTATTCTTGA
AGCATTTTCA GTAGTATACT ATTGCACTTT TAGTTTAACT ACTTAACTAG TATTTGGTTG GTGTTTATGC ACATTACAGT
AGCTGGTCTA CTTACAAGAA TTATTTTTCT TGACCTTTAG ATAAAAGCCC TTCATTTATA TGATTGCTTG AGAGCGAACA
AATCAACTTC TGCATGGGGT GTTGAGGCCC GTGTTCCGTT CCTTGACAAA AACTTCATCA ATGTAGCTAT GGACATTGAT
CCTGAATGGA AAATGGTATG TACACCGGAC ATCAACTTTT ATTGCAGTTA TTTTTCTTAT ATTGTAACCA GTACTGTCAC
TTTCTAACAC TTATTATCCT GTAAATTTTA GATAAAACGT GATCTTGGCC GTATTGAGAA ATGGGTTCTC CGGAATGCAT
TTGATGATGA GGAGAAGCCC TATTTACCTA AGGTTGCAAA AAGTTAAACT TTTTGAGTCG TATTTGACCT ATAATGTACA
TAAACTTCCA TATGTGCTTA AACTTATAAT TTATTCGTCT TGCACAGCAC ATTCTATACA GGCAAAAGGA GCAATTCAGT
GATGGTGTTG GGTACAGTTG GATTGATGGA TTGAAGGATC ATGCAAATGA ACATGTATAC TGTCTTCTCT GTTTTAAAAC
TATTGACAAC TTAGCGGTTT TCATTTTTTA GCCTACAGTT TGTTTGATTT CTTCTGACCT AAGCTGGAAT TCACATATTT
TTCTGTTCAT TTTCAGGTAT CAGATTCCAT GATGATGAAC GCTAGCTTTG TTTACCCAGA AAACACTCCA GTTACAAAAG
AAGCGTACTA TTATAGGACA ATATTCGAGA AATTCTTTCC CAAGGCATGG AAGATACTAT CAACTTTTGC TGTTCTCATA
CTATGCTGAG CTATGCCCTA GCTAATTAAC TTTCGGTTTT ATGCAGAATG CTGCTAGGTT GACAGTACCT GGAGGTCCTA
GCGTCGCGTG CAGCACTGCT AAAGCTGTTG AATGGGACGC AGCCTGGTCC AAAAACCTTG ATCCATCTGG TCGTGCTGCT
CTTGGTGTTC ATGATGCTGC ATATGAAGAT ACTCTACAAA AATCTCCTGC CTCTGCCAAT CCTGTCTTGG ATAACGGCTT
TGGTCCAGCC CTTGGGGAAA GCATGGTCAA AACCGTTGCT TCAGCCACTG CCGTTTAACT TTCTATCGTC GCATAAAACT
CCGTAGTTTG TTGTTCTTGG TTCAATCCCA GCTTCTTTCA GATGTCGTTA GTTTCTTCAA ACATGTAATG GAGATGCGTG
CTTTTCCTGG CTTGTTAGTT ACTGTATGCT TGTCATCGTG TATGTTTTCT TTTCTTTTCC AATATGCAAA CTGTTTGGTC
GTGGACTGAT CAGAACATTG TAAATATGAA TAACCGCGAC TGATATCCTC AAGTTGCTTT TGGTTTGCAA TAGTTCTAAT
CTTGATGTTC TGCTGGGAAT CGGAAGATGT TATGCAGTAT GCGTATTGTT GGGGTGTAAC CGTGTAAGTG CATCTGAAAT
GAAGTTACGG GCGATGGTAA CTGGG

Locus: Os06g0265000

Loading...

Locus: Os06g0265000

Loading...