Os06t0266800-01

Locus

Os06g0266800

Description

Similar to Gibberellin-stimulated protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GW6

CGSNL Gene Name

GRAIN WIDTH 6

Oryzabase Gene Symbol Synonym(s)

OsGSR1, GSR1, OsGASR7, GASR7, OsGW6, OsGASR7/GW6

Oryzabase Gene Name Synonym(s)

GAST family gene in rice 1, GA-stimulated transcript family gene in rice 1, gibberellic acid- stimulated regulator 7

Transcript Evidence

AK062516 (DDBJ, Best hit)

Protein Evidence

Q53AN3 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Full-length cDNA

001-104-C07 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0266800-01)

Others

Oryzabase (14270)

Transcript

433 bp

>Os06t0266800-01 Similar to Gibberellin-stimulated protein.
ACAATCTCTCTAACCTCTCCTTCAACCTGATTACTATATATCTTGAATCTTGGGTTAATC
TTGACGTTCTTGTTCGTTCTTGTTTCTCGCGTGCAGGAGGTGATGGCAGGAGGGCGCGGG
CGCGGCGGCGGCGGCGGCGGAGGGGTGGCCGGCGGCGGGAACCTGAGGCCGTGGGAGTGC
TCGCCCAAGTGCGcggggaggtgctccaacacgcagtacaagaaggcgtgcctgacgttc
tgcaacaagtgctgcgccaagtgcctGTGCGTGCCGCCCGGCACCTACGGCAACAAGGGC
GCCTGCCCCTGCTACAACAACTGGAAGACCAAGGAAGGCGGCCCCAAGTGCCCCTAAGAT
GCATGCCTTTTTTTCTTTCTTCTTTTTTTTTTGTTTTTTTACCGTATGATTAATACCTCC
TACTAGTTCTACT

CDS

255 bp

>Os06t0266800-01 Similar to Gibberellin-stimulated protein.
ATGGCAGGAGGGCGCGGGCGCGGCGGCGGCGGCGGCGGAGGGGTGGCCGGCGGCGGGAAC
CTGAGGCCGTGGGAGTGCTCGCCCAAGTGCGcggggaggtgctccaacacgcagtacaag
aaggcgtgcctgacgttctgcaacaagtgctgcgccaagtgcctGTGCGTGCCGCCCGGC
ACCTACGGCAACAAGGGCGCCTGCCCCTGCTACAACAACTGGAAGACCAAGGAAGGCGGC
CCCAAGTGCCCCTAA

Protein

84 aa

>Os06t0266800-01 Similar to Gibberellin-stimulated protein.
MAGGRGRGGGGGGGVAGGGNLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPG
TYGNKGACPCYNNWKTKEGGPKCP*

5'UTR

chr06:8848628..8848729 (- strand) : 102 bp

CDS

chr06:8848373..8848627 (- strand) : 255 bp

3'UTR

chr06:8848297..8848372 (- strand) : 76 bp

FASTA

>Os06t0266800-01 class=Sequence position=chr06:8848297..8848729 (- strand)
ACAATCTCTC TAACCTCTCC TTCAACCTGA TTACTATATA TCTTGAATCT TGGGTTAATC TTGACGTTCT TGTTCGTTCT
TGTTTCTCGC GTGCAGGAGG TGATGGCAGG AGGGCGCGGG CGCGGCGGCG GCGGCGGCGG AGGGGTGGCC GGCGGCGGGA
ACCTGAGGCC GTGGGAGTGC TCGCCCAAGT GCGcggggag gtgctccaac acgcagtaca agaaggcgtg cctgacgttc
tgcaacaagt gctgcgccaa gtgcctGTGC GTGCCGCCCG GCACCTACGG CAACAAGGGC GCCTGCCCCT GCTACAACAA
CTGGAAGACC AAGGAAGGCG GCCCCAAGTG CCCCTAAGAT GCATGCCTTT TTTTCTTTCT TCTTTTTTTT TTGTTTTTTT
ACCGTATGAT TAATACCTCC TACTAGTTCT ACT

Locus: Os06g0266800

Loading...

Locus: Os06g0266800

Loading...