Os06t0272850-00

Locus

Os06g0272850

Description

Domain of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL65, TBL65

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 65

Transcript Evidence

CT828123 (DDBJ, Best hit)

Protein Evidence

NP_001057365.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Expression Databases

TENOR (Os06t0272850-00)

Others

Oryzabase (21518)

Transcript

1524 bp

>Os06t0272850-00 Domain of unknown function DUF231, plant domain containing protein.
ACGCACAAATATATATACACCTGAATGGACTCTACTATTGCAAGTGTTTCACACACAATT
CTTGAGATAGATATAGATTCTTAGTTTCCTCCCAGTGCCAATGACGCCTCTTAATAATCT
CTGCAATTTTCGTGTCAAGAAGCAGTACTACAACCCCAGAAGGCCGCCGACGAGGCCTGC
AACATATTTAGGGGAGAGTGGGTTCCGGATCCTGATGCACCTTACTACACCAACAACACC
TGCTCGGTCATCCACGAGCACTATGACTGTATGAAGTACGGAAAGCCGGACCTTGGCTTC
GTGCAGTGGCGGTGGCGTCCCGACAGTTGTGATCTCCCCCGTCTCGACCCGGCGCGCTTC
CTCTCCTCCATGAGGGGGAAGACCTTGGCCTTCATTGGGGATTCCCTTGCCAGGAACCAC
ATGAACTCCCTCATCTGTCTACTGACCAGGGTCGCCGAGCCGACGACGAGCTGGCCGAGC
AGCGAGCACACGGTGTACCACTACGGCGGCGGCTACAACTTCACCGTCCTCAGCTTCTGG
GCGCCGTTCCTGGTCCAGAACGAGCTCGTCGACGCCGACGGGCCGGCGCACACGGGCCTG
TGGAACCTCTACCTCGACGAGCCCGACGCAGTGTGGGCGCCGCACGTCCCGGCGTTCGAC
TACGCCGTCGTGTCGGCGTCGAGCTGGTTCTACCGGCCGTCGATGCTGTACGAGGCCGGC
CGGCTCGTGGGCTGCCACCACTGCCTCCTCCCCAACGTCACCGACCTCACGCTGCGGTAC
GCGCTCCGCATGGCCACCCGCGCCGCGCTCCGCGCCGTGGTGGGCGGCGGCGGCGGCGGC
GGCGTGACCGCCGTGCTTCGGACCGTGTCGCCGTCGCAGTACGAGGGCGGGGAGTGGAAC
AAGGACGGGAACTGCGTCCGGACGCGGCCGTACCGGCGCGGCGAGAAGACGCTGCAGGGC
GTCGAGCTCGACTTCCACACGCTGCAGGTTAATTTCTTGATTTTTCTCCATTGATCTAGT
GATCAATTATCTTGTTCTTTCTAGGGAACGTGTGTTCTGAGCTTCGTAGGTGGAGGAGTT
CGAGGCGGCGAAGAGGGCGGCGAGCGGCGGTGGGGCGAGGATGATGCTGATGGACACGAC
GGAGGCGATGATACTGCGGGCGGACGCGCACCCGAGCAGGTACAGGGGATGGACGCGTCG
CAAGGGATGGATGAAGGAGTACTTCACCATCTCCAACGACTGCGTGCACTGGTGCGTCCC
CGGCGCCGTCGACGCCTGGAACGACATGCTCTCACACATGTTGCTCACATCGCAAAGCTA
GTTAGTTAGGTTATTGATCAAACGAACGTAGCAGCCGAAAAAAACAGAGAAAAATACATT
CACTCCTGAATTCAGTCTAGAATTTCAAAACCACCGTCCATGATCCATGTGAATTTCTAG
CAAATTGCACGAGCTGAACTCAAACATTTTGGTCCTGTTTGCTGCATTCGCAAAGGGTTA
TTGTGATTCCGTCTGTATGGACCT

CDS

897 bp

>Os06t0272850-00 Domain of unknown function DUF231, plant domain containing protein.
TCTCTGCAATTTTCGTGTCAAGAAGCAGTACTACAACCCCAGAAGGCCGCCGACGAGGCC
TGCAACATATTTAGGGGAGAGTGGGTTCCGGATCCTGATGCACCTTACTACACCAACAAC
ACCTGCTCGGTCATCCACGAGCACTATGACTGTATGAAGTACGGAAAGCCGGACCTTGGC
TTCGTGCAGTGGCGGTGGCGTCCCGACAGTTGTGATCTCCCCCGTCTCGACCCGGCGCGC
TTCCTCTCCTCCATGAGGGGGAAGACCTTGGCCTTCATTGGGGATTCCCTTGCCAGGAAC
CACATGAACTCCCTCATCTGTCTACTGACCAGGGTCGCCGAGCCGACGACGAGCTGGCCG
AGCAGCGAGCACACGGTGTACCACTACGGCGGCGGCTACAACTTCACCGTCCTCAGCTTC
TGGGCGCCGTTCCTGGTCCAGAACGAGCTCGTCGACGCCGACGGGCCGGCGCACACGGGC
CTGTGGAACCTCTACCTCGACGAGCCCGACGCAGTGTGGGCGCCGCACGTCCCGGCGTTC
GACTACGCCGTCGTGTCGGCGTCGAGCTGGTTCTACCGGCCGTCGATGCTGTACGAGGCC
GGCCGGCTCGTGGGCTGCCACCACTGCCTCCTCCCCAACGTCACCGACCTCACGCTGCGG
TACGCGCTCCGCATGGCCACCCGCGCCGCGCTCCGCGCCGTGGTGGGCGGCGGCGGCGGC
GGCGGCGTGACCGCCGTGCTTCGGACCGTGTCGCCGTCGCAGTACGAGGGCGGGGAGTGG
AACAAGGACGGGAACTGCGTCCGGACGCGGCCGTACCGGCGCGGCGAGAAGACGCTGCAG
GGCGTCGAGCTCGACTTCCACACGCTGCAGGTTAATTTCTTGATTTTTCTCCATTGA

Protein

299 aa

>Os06t0272850-00 Domain of unknown function DUF231, plant domain containing protein.
SLQFSCQEAVLQPQKAADEACNIFRGEWVPDPDAPYYTNNTCSVIHEHYDCMKYGKPDLG
FVQWRWRPDSCDLPRLDPARFLSSMRGKTLAFIGDSLARNHMNSLICLLTRVAEPTTSWP
SSEHTVYHYGGGYNFTVLSFWAPFLVQNELVDADGPAHTGLWNLYLDEPDAVWAPHVPAF
DYAVVSASSWFYRPSMLYEAGRLVGCHHCLLPNVTDLTLRYALRMATRAALRAVVGGGGG
GGVTAVLRTVSPSQYEGGEWNKDGNCVRTRPYRRGEKTLQGVELDFHTLQVNFLIFLH*

5'UTR

chr06:9206391..9206507 (- strand) : 117 bp

CDS

chr06:9206349..9206390 (- strand) : 42 bp

chr06:9205925..9206215 (- strand) : 291 bp

chr06:9205231..9205794 (- strand) : 564 bp

3'UTR

chr06:9204721..9205230 (- strand) : 510 bp

FASTA

>Os06t0272850-00 class=Sequence position=chr06:9204721..9206507 (- strand)
ACGCACAAAT ATATATACAC CTGAATGGAC TCTACTATTG CAAGTGTTTC ACACACAATT CTTGAGATAG ATATAGATTC
TTAGTTTCCT CCCAGTGCCA ATGACGCCTC TTAATAATCT CTGCAATTTT CGTGTCAAGA AGCAGTACTA CAACCCCAGG
TGCTTGATCC CCGCCGTCTC TCTCCTCCTA TTCGTCGTCA TCCTCACCGT CTCTAATACA TACTTCCCCT TCCCGACAAC
TAAGTCGCGA ACACTGTCTT ACTCTTCCTT CTCCTCCTCC CCCGGTGGGC AGAAGGCCGC CGACGAGGCC TGCAACATAT
TTAGGGGAGA GTGGGTTCCG GATCCTGATG CACCTTACTA CACCAACAAC ACCTGCTCGG TCATCCACGA GCACTATGAC
TGTATGAAGT ACGGAAAGCC GGACCTTGGC TTCGTGCAGT GGCGGTGGCG TCCCGACAGT TGTGATCTCC CCCGTCTCGA
CCCGGCGCGC TTCCTCTCCT CCATGAGGGG GAAGACCTTG GCCTTCATTG GGGATTCCCT TGCCAGGAAC CACATGAACT
CCCTCATCTG TCTACTGACC AGGGTAAAAA AGTGAAAAAC GTGCCGGATT TGCTACAGTA CTAGCTTCGA TCTGACCCGT
CGATCGCTTG ATCGGACGGT CAGAAATGGG CCAGCAGCAA CAAGGGTGTG ACGTTTTGTT GGCCGGCCTG CAGGTCGCCG
AGCCGACGAC GAGCTGGCCG AGCAGCGAGC ACACGGTGTA CCACTACGGC GGCGGCTACA ACTTCACCGT CCTCAGCTTC
TGGGCGCCGT TCCTGGTCCA GAACGAGCTC GTCGACGCCG ACGGGCCGGC GCACACGGGC CTGTGGAACC TCTACCTCGA
CGAGCCCGAC GCAGTGTGGG CGCCGCACGT CCCGGCGTTC GACTACGCCG TCGTGTCGGC GTCGAGCTGG TTCTACCGGC
CGTCGATGCT GTACGAGGCC GGCCGGCTCG TGGGCTGCCA CCACTGCCTC CTCCCCAACG TCACCGACCT CACGCTGCGG
TACGCGCTCC GCATGGCCAC CCGCGCCGCG CTCCGCGCCG TGGTGGGCGG CGGCGGCGGC GGCGGCGTGA CCGCCGTGCT
TCGGACCGTG TCGCCGTCGC AGTACGAGGG CGGGGAGTGG AACAAGGACG GGAACTGCGT CCGGACGCGG CCGTACCGGC
GCGGCGAGAA GACGCTGCAG GGCGTCGAGC TCGACTTCCA CACGCTGCAG GTTAATTTCT TGATTTTTCT CCATTGATCT
AGTGATCAAT TATCTTGTTC TTTCTAGGGA ACGTGTGTTC TGAGCTTCGT AGGTGGAGGA GTTCGAGGCG GCGAAGAGGG
CGGCGAGCGG CGGTGGGGCG AGGATGATGC TGATGGACAC GACGGAGGCG ATGATACTGC GGGCGGACGC GCACCCGAGC
AGGTACAGGG GATGGACGCG TCGCAAGGGA TGGATGAAGG AGTACTTCAC CATCTCCAAC GACTGCGTGC ACTGGTGCGT
CCCCGGCGCC GTCGACGCCT GGAACGACAT GCTCTCACAC ATGTTGCTCA CATCGCAAAG CTAGTTAGTT AGGTTATTGA
TCAAACGAAC GTAGCAGCCG AAAAAAACAG AGAAAAATAC ATTCACTCCT GAATTCAGTC TAGAATTTCA AAACCACCGT
CCATGATCCA TGTGAATTTC TAGCAAATTG CACGAGCTGA ACTCAAACAT TTTGGTCCTG TTTGCTGCAT TCGCAAAGGG
TTATTGTGAT TCCGTCTGTA TGGACCT

Locus: Os06g0272850

Loading...

Locus: Os06g0272850

Loading...