Os06t0273700-01

Locus

Os06g0273700

Description

Protein of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Lip, OsTBL56, TBL56, OsTBL60, TBL60

Oryzabase Gene Name Synonym(s)

leaf senescence protein, trichome birefringence-like 56, trichome birefringence-like 60

Transcript Evidence

AK106489 (DDBJ, Best hit)

Protein Evidence

A2YBL8 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

002-105-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0273700-01)

RiceXPro (AK106489)

Others

Oryzabase (16228)

Oryzabase (21520)

Oryzabase (21521)

KEGG (Os06t0273700-01)

Transcript

1562 bp

>Os06t0273700-01 Protein of unknown function DUF231, plant domain containing protein.
GTGTCAGTGGAGCTCGATCGATCGGCGACCTCCCACTACTTACACGGCGACATGGCGACG
CCACCGGCGAGGCCTCGTCGGTAACCGTCATGAAGCGCCTCTCCATCCGCGGCCTCCTCG
CCGGGGCTCGCCGGACCCGCCACGCCGTTGCCGCCAAGGCCACCACGTCCGTCCCGGCTC
TCGTCGCGCTCCTCTTCTTCTTCGCCGCCGCCACCTTCTCGGTCTTCTCCCTCGGCTCCT
TCCGTTGGCCTGGCGCCGCCGATGATGGCGGTGCGGCTGCCTGCGACGCCGCGCTGGCGC
GGGGGCGGGGCGAGTGGATGCGCGACGCCGGCGCGGCGCCGTACTACACCAACGCGACGT
GCGGGTTCATCCAGAACTACCAGAACTGCATGAAGCACGGGAGGCCCAGCATGGAGTTCT
TGCGGTGGCGGTGGCGTCCCGGTGACGGCGGCGAGGGGTGCGAGCCGCTCGGGCCGTTCG
ACGCGGCGCGGTTCTTCCGGCTCGTGCGCGGGAGGTCGATGCTGTTCGTCGGCGACTCGC
TGGCGAGCAGCCACGTGACGTCCCTCGTGTGCGCGCTGTCGCAGGTGGAGGCGCCGGCGA
GGTCGCGCGACGCGGCGGCGGGGTTCGAGCACTGGCGCTTCCCGGCGCACGGCTTCGCCG
TCGCCTACTTCTGGACGCCGTTCCAGGTCCGGTGGCGCCTGACGCGCGGCCCGCCGGAGG
CGGTCGGTCCGGAACGGCAGGGCGAGGTGTTCGCCGGCCCGAGCGACCTCCACCTCGACG
AGCCCGACGAGCGGTGGACGTCCGCCGCCAAGAGCCACGACTACGTCGTCCTCTCCGCGT
CGCACTGGTTCGCGCGCCCCGCCGTGTACTACCAGCACGGCCGCGTCGTCGGCTGCCACG
ACTGCGGCGACAGCAACGCCACCGCCACGGCCATTGTCAAGCAGCCAGAGCACGCGCAGC
GGGCGGCGTTCCGCGCCGTGCTCGGGGCGCTGGCGCGGCTGGACGGGTTCAACGGCACGG
CGATCCTGCGCACGGTGGCGCCGACGCACTACGAGAACGGCGGGTGGTTCGACGGCGGGG
AGTGCACCGCGACGCGGCCGGCCAGCGAGAGCGAGGACGGGGCGGCGCCGGAGATGGCGG
CGACGGAGGCGGAGTTCTACCGGGCGCAGGTCGAGGAGTTCGCCGCGGCGGCGGCGGCGG
CGGCGGCGAGGAACGGCGGCAAGCGGGCGCGGCTGAGGCTGATGGACGTGACGCGGATGA
TGCTGCTCCGGCCGGACGGGCACCCGGACCGGCACGGGCATGGCGGCGGCGAGCACGACG
GATTCGAGATCGACTGCCTGCACTGGTGCTTGCCCGGAGCGATCGACGTGTGGAACGACC
TGCTGCTTCAGATAATCGCATCCTCATGACAACGCTACCTGACGTGACACTCAGCAAAGC
ACAGACAAATATGGAGCAATGTAGATGAAAATTTCCCTTGGATTTGCTTTTTTTTTTTTT
TTTTTTTTTGTCTTTGCCTCGTTGAGTTGCGGAATCAGATGCTTAGATATATTGATCTGA
GT

CDS

1320 bp

>Os06t0273700-01 Protein of unknown function DUF231, plant domain containing protein.
ATGAAGCGCCTCTCCATCCGCGGCCTCCTCGCCGGGGCTCGCCGGACCCGCCACGCCGTT
GCCGCCAAGGCCACCACGTCCGTCCCGGCTCTCGTCGCGCTCCTCTTCTTCTTCGCCGCC
GCCACCTTCTCGGTCTTCTCCCTCGGCTCCTTCCGTTGGCCTGGCGCCGCCGATGATGGC
GGTGCGGCTGCCTGCGACGCCGCGCTGGCGCGGGGGCGGGGCGAGTGGATGCGCGACGCC
GGCGCGGCGCCGTACTACACCAACGCGACGTGCGGGTTCATCCAGAACTACCAGAACTGC
ATGAAGCACGGGAGGCCCAGCATGGAGTTCTTGCGGTGGCGGTGGCGTCCCGGTGACGGC
GGCGAGGGGTGCGAGCCGCTCGGGCCGTTCGACGCGGCGCGGTTCTTCCGGCTCGTGCGC
GGGAGGTCGATGCTGTTCGTCGGCGACTCGCTGGCGAGCAGCCACGTGACGTCCCTCGTG
TGCGCGCTGTCGCAGGTGGAGGCGCCGGCGAGGTCGCGCGACGCGGCGGCGGGGTTCGAG
CACTGGCGCTTCCCGGCGCACGGCTTCGCCGTCGCCTACTTCTGGACGCCGTTCCAGGTC
CGGTGGCGCCTGACGCGCGGCCCGCCGGAGGCGGTCGGTCCGGAACGGCAGGGCGAGGTG
TTCGCCGGCCCGAGCGACCTCCACCTCGACGAGCCCGACGAGCGGTGGACGTCCGCCGCC
AAGAGCCACGACTACGTCGTCCTCTCCGCGTCGCACTGGTTCGCGCGCCCCGCCGTGTAC
TACCAGCACGGCCGCGTCGTCGGCTGCCACGACTGCGGCGACAGCAACGCCACCGCCACG
GCCATTGTCAAGCAGCCAGAGCACGCGCAGCGGGCGGCGTTCCGCGCCGTGCTCGGGGCG
CTGGCGCGGCTGGACGGGTTCAACGGCACGGCGATCCTGCGCACGGTGGCGCCGACGCAC
TACGAGAACGGCGGGTGGTTCGACGGCGGGGAGTGCACCGCGACGCGGCCGGCCAGCGAG
AGCGAGGACGGGGCGGCGCCGGAGATGGCGGCGACGGAGGCGGAGTTCTACCGGGCGCAG
GTCGAGGAGTTCGCCGCGGCGGCGGCGGCGGCGGCGGCGAGGAACGGCGGCAAGCGGGCG
CGGCTGAGGCTGATGGACGTGACGCGGATGATGCTGCTCCGGCCGGACGGGCACCCGGAC
CGGCACGGGCATGGCGGCGGCGAGCACGACGGATTCGAGATCGACTGCCTGCACTGGTGC
TTGCCCGGAGCGATCGACGTGTGGAACGACCTGCTGCTTCAGATAATCGCATCCTCATGA

Protein

440 aa

>Os06t0273700-01 Protein of unknown function DUF231, plant domain containing protein.
MKRLSIRGLLAGARRTRHAVAAKATTSVPALVALLFFFAAATFSVFSLGSFRWPGAADDG
GAAACDAALARGRGEWMRDAGAAPYYTNATCGFIQNYQNCMKHGRPSMEFLRWRWRPGDG
GEGCEPLGPFDAARFFRLVRGRSMLFVGDSLASSHVTSLVCALSQVEAPARSRDAAAGFE
HWRFPAHGFAVAYFWTPFQVRWRLTRGPPEAVGPERQGEVFAGPSDLHLDEPDERWTSAA
KSHDYVVLSASHWFARPAVYYQHGRVVGCHDCGDSNATATAIVKQPEHAQRAAFRAVLGA
LARLDGFNGTAILRTVAPTHYENGGWFDGGECTATRPASESEDGAAPEMAATEAEFYRAQ
VEEFAAAAAAAAARNGGKRARLRLMDVTRMMLLRPDGHPDRHGHGGGEHDGFEIDCLHWC
LPGAIDVWNDLLLQIIASS*

5'UTR

chr06:9253960..9254048 (+ strand) : 89 bp

CDS

chr06:9254049..9255368 (+ strand) : 1320 bp

3'UTR

chr06:9255369..9255521 (+ strand) : 153 bp

FASTA

>Os06t0273700-01 class=Sequence position=chr06:9253960..9255521 (+ strand)
GTGTCAGTGG AGCTCGATCG ATCGGCGACC TCCCACTACT TACACGGCGA CATGGCGACG CCACCGGCGA GGCCTCGTCG
GTAACCGTCA TGAAGCGCCT CTCCATCCGC GGCCTCCTCG CCGGGGCTCG CCGGACCCGC CACGCCGTTG CCGCCAAGGC
CACCACGTCC GTCCCGGCTC TCGTCGCGCT CCTCTTCTTC TTCGCCGCCG CCACCTTCTC GGTCTTCTCC CTCGGCTCCT
TCCGTTGGCC TGGCGCCGCC GATGATGGCG GTGCGGCTGC CTGCGACGCC GCGCTGGCGC GGGGGCGGGG CGAGTGGATG
CGCGACGCCG GCGCGGCGCC GTACTACACC AACGCGACGT GCGGGTTCAT CCAGAACTAC CAGAACTGCA TGAAGCACGG
GAGGCCCAGC ATGGAGTTCT TGCGGTGGCG GTGGCGTCCC GGTGACGGCG GCGAGGGGTG CGAGCCGCTC GGGCCGTTCG
ACGCGGCGCG GTTCTTCCGG CTCGTGCGCG GGAGGTCGAT GCTGTTCGTC GGCGACTCGC TGGCGAGCAG CCACGTGACG
TCCCTCGTGT GCGCGCTGTC GCAGGTGGAG GCGCCGGCGA GGTCGCGCGA CGCGGCGGCG GGGTTCGAGC ACTGGCGCTT
CCCGGCGCAC GGCTTCGCCG TCGCCTACTT CTGGACGCCG TTCCAGGTCC GGTGGCGCCT GACGCGCGGC CCGCCGGAGG
CGGTCGGTCC GGAACGGCAG GGCGAGGTGT TCGCCGGCCC GAGCGACCTC CACCTCGACG AGCCCGACGA GCGGTGGACG
TCCGCCGCCA AGAGCCACGA CTACGTCGTC CTCTCCGCGT CGCACTGGTT CGCGCGCCCC GCCGTGTACT ACCAGCACGG
CCGCGTCGTC GGCTGCCACG ACTGCGGCGA CAGCAACGCC ACCGCCACGG CCATTGTCAA GCAGCCAGAG CACGCGCAGC
GGGCGGCGTT CCGCGCCGTG CTCGGGGCGC TGGCGCGGCT GGACGGGTTC AACGGCACGG CGATCCTGCG CACGGTGGCG
CCGACGCACT ACGAGAACGG CGGGTGGTTC GACGGCGGGG AGTGCACCGC GACGCGGCCG GCCAGCGAGA GCGAGGACGG
GGCGGCGCCG GAGATGGCGG CGACGGAGGC GGAGTTCTAC CGGGCGCAGG TCGAGGAGTT CGCCGCGGCG GCGGCGGCGG
CGGCGGCGAG GAACGGCGGC AAGCGGGCGC GGCTGAGGCT GATGGACGTG ACGCGGATGA TGCTGCTCCG GCCGGACGGG
CACCCGGACC GGCACGGGCA TGGCGGCGGC GAGCACGACG GATTCGAGAT CGACTGCCTG CACTGGTGCT TGCCCGGAGC
GATCGACGTG TGGAACGACC TGCTGCTTCA GATAATCGCA TCCTCATGAC AACGCTACCT GACGTGACAC TCAGCAAAGC
ACAGACAAAT ATGGAGCAAT GTAGATGAAA ATTTCCCTTG GATTTGCTTT TTTTTTTTTT TTTTTTTTTG TCTTTGCCTC
GTTGAGTTGC GGAATCAGAT GCTTAGATAT ATTGATCTGA GT