Os06t0274500-01

Locus

Os06g0274500

Description

Similar to SERK1 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSERL2, SERL2, SERK1, OsBAK1-7, BAK1-7

Oryzabase Gene Name Synonym(s)

SERK-like gene 2, Somatic Embryogenesis Protein Kinase 1, bri1-associated receptor kinase 1 (BAK1) homologue 7

Transcript Evidence

AK066417 (DDBJ, Best hit)

Protein Evidence

NP_001147975.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Leucine-rich repeat (IPR001611)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J013067F20 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0274500-01)

RiceXPro (AK066417)

Others

Oryzabase (13025)

KEGG (Os06t0274500-01)

Transcript

2498 bp

>Os06t0274500-01 Similar to SERK1 (Fragment).
GTTAGTTCGAGCGCACACACACAATCACACATTGCACGCGCAGACGCAGCCACTGCTTCT
TCTTCCTCCTCTTCTCCCAGGAAAGAGCTCACCTGACCTGACCACCTGAGGTTGTAGTTG
CTGGTTTGCTTGCTAGCTTCGTCGTCTCCTCCTACCTGAGCTCAGCAATGGAGCCGCCCT
TCTTCCTCCTCCTGCTGCTGCTCGTGGTCTCCTCCTCCTCCCCTTCCGCCGCCCTCCTCT
CCGCCAAGGGCGTCAACAACGAAGTGCAAGCTCTGATTGTGATCAAGAACCTGCTCAAGG
ACCCCCATGGCGTGCTCAAGAGCTGGGACCAGAACTCCGTCGACCCCTGCAGCTGGGCCA
TGATCACCTGCTCCCCGGATTTCCTCGTCACTGGCCTGGAAGCTCCAAGCCAGCATCTCT
CTGGCCTGCTCTCACCAAGCATCGGCAACCTGACCAATCTTGAGACTGTTCTCCTGCAGA
ACAACAACATAACCGGGCCAATCCCAGCAGAGATTGGCAGGCTGGAGAACCTCAAGACGC
TTGATCTCTCCAGCAACAGCTTCTATGGCGAAATCCCCAGCTCTGTGGGCCACCTCGAGA
GCCTCCAGTACTTGAGGCTCAACAACAACACCCTGTCTGGTCCATTCCCTTCTGCATCAG
CTAACCTGTCACACCTTGTTTTCCTAGATTTGTCATATAACAACCTGAGTGGCCCGATTC
CAGAATCATTGGCAAGAACTTACAACATAGTGGGGAATCCCCTCATCTGCGACGCCAACA
GGGAGCAGGATTGCTACGGGACGGCGCCGATGCCGATGAGCTACAGCCTGAACGGCTCGC
GGGGCGGCGCGCTGCCGCCGGCGGCGAGGGACAGGGGGCACAAGTTCGCCGTCGCGTTCG
GCTCCACCGCCGGCTGCATGGGCCTCCTCCTCCTCGCCGCCGGTTTCCTCTTCTGGTGGC
GCCACCGCCGCAACCGGCAGATCCTCTTTGACGTCGACGAGCAGCAGATTGAGAACGTGA
ACCTGGGGAACGTGAAGAGGTTCAGCTTCAGGGAGCTGCAGGCGGCGACGGAGGGGTTCA
GCGGGAAGAACATCCTGGGGAAAGGAGGGTTCGGGAACGTGTACAGGGGGCAGCTCCCCG
ACGGGACGCTGGTGGCGGTGAAGCGGCTCAAGGACGGCAACGCGGCCGGCGGCGAGGCCC
AGTTCCAGACGGAGGTGGAGATGATCAGCCTCGCCCTCCACCGCAACCTCCTCCGCCTCT
ACGGCTTCTGCATGACCGCCACCGAGCGCCTCCTAGTCTACCCCTTCATGTCCAACGGCA
GCGTCGCCTCCCGCCTCAAAGcgaagccggcgttggagtgggggacgaggaggaggatcg
cggtgggggcggcgaggggcctggtgtacctgcacgagcagtgcgaccccaagatcatcc
accgcgacgtcaaggccgccaacgtgctgctggacgaggcgtgcgaggccgtcgtcggcg
acttcgggctggccaagctgctggaccaccgggagtcgcacgtcaccacggcggtgcggg
gcaccgtcggccacatcgcgccggagtacctgtccacggggcagtcgtcggaccggaccg
acgtcttcggcttcggcatcctgctgctggagctcgtcaccggccagacggcgctcgagt
tcggcaagtcgtccaaccacaagggcgccatgctggactgggtgaagaagatgcagtcgg
agaagaaggtggaggtgctggtggacaaggggttaggcggagggtacgaccgggtggagg
tggaggagatggtgcaggtggctctcctctgcacccagtacctccccgcccaccgccccc
gcatgtccgacgtcgtccgcatgctcgagggcgacggcctcgccgaccgctgggagaagg
cctccggccactccaccgccgccgccgactccctctcccactcccaccgcacctcagacc
cggcgccgcccgccgccgacttcgccgccgccttcggccgctgcttctccgacctcaccg
acgactcctccctcctcgtccaggccgtcgagctctccggccccagataacaccaccaTG
ATCGAGTAGCTGTGGTGTGTGGCTCTTCTTGTACAGCATGCTTGCATGGAGCTCTCTGTC
TTTCTGTCTGAATATTAATGTAGCTAGCTAGGTTGGGAAAtacttccctgtttcatatta
taaaactttttagcattacccatacattcatatatatatgttaataaatctagatatata
tgtatgcctagatttattaacatctatatgaatgaatgtgggcaatgctagaaagtttta
taacctgaaatggaggtagtaATAATTATATTTTACTAAGGTAATTACTAATTAGTGATG
CGTATATATTTATATCATTTTAGATGAACTGTACAAACACAAGAGGAGAGGACAAGGACT
TGTACTTTTCCGTGTCTCCATATATACTTGATGTTAAT

CDS

1923 bp

>Os06t0274500-01 Similar to SERK1 (Fragment).
ATGGAGCCGCCCTTCTTCCTCCTCCTGCTGCTGCTCGTGGTCTCCTCCTCCTCCCCTTCC
GCCGCCCTCCTCTCCGCCAAGGGCGTCAACAACGAAGTGCAAGCTCTGATTGTGATCAAG
AACCTGCTCAAGGACCCCCATGGCGTGCTCAAGAGCTGGGACCAGAACTCCGTCGACCCC
TGCAGCTGGGCCATGATCACCTGCTCCCCGGATTTCCTCGTCACTGGCCTGGAAGCTCCA
AGCCAGCATCTCTCTGGCCTGCTCTCACCAAGCATCGGCAACCTGACCAATCTTGAGACT
GTTCTCCTGCAGAACAACAACATAACCGGGCCAATCCCAGCAGAGATTGGCAGGCTGGAG
AACCTCAAGACGCTTGATCTCTCCAGCAACAGCTTCTATGGCGAAATCCCCAGCTCTGTG
GGCCACCTCGAGAGCCTCCAGTACTTGAGGCTCAACAACAACACCCTGTCTGGTCCATTC
CCTTCTGCATCAGCTAACCTGTCACACCTTGTTTTCCTAGATTTGTCATATAACAACCTG
AGTGGCCCGATTCCAGAATCATTGGCAAGAACTTACAACATAGTGGGGAATCCCCTCATC
TGCGACGCCAACAGGGAGCAGGATTGCTACGGGACGGCGCCGATGCCGATGAGCTACAGC
CTGAACGGCTCGCGGGGCGGCGCGCTGCCGCCGGCGGCGAGGGACAGGGGGCACAAGTTC
GCCGTCGCGTTCGGCTCCACCGCCGGCTGCATGGGCCTCCTCCTCCTCGCCGCCGGTTTC
CTCTTCTGGTGGCGCCACCGCCGCAACCGGCAGATCCTCTTTGACGTCGACGAGCAGCAG
ATTGAGAACGTGAACCTGGGGAACGTGAAGAGGTTCAGCTTCAGGGAGCTGCAGGCGGCG
ACGGAGGGGTTCAGCGGGAAGAACATCCTGGGGAAAGGAGGGTTCGGGAACGTGTACAGG
GGGCAGCTCCCCGACGGGACGCTGGTGGCGGTGAAGCGGCTCAAGGACGGCAACGCGGCC
GGCGGCGAGGCCCAGTTCCAGACGGAGGTGGAGATGATCAGCCTCGCCCTCCACCGCAAC
CTCCTCCGCCTCTACGGCTTCTGCATGACCGCCACCGAGCGCCTCCTAGTCTACCCCTTC
ATGTCCAACGGCAGCGTCGCCTCCCGCCTCAAAGcgaagccggcgttggagtgggggacg
aggaggaggatcgcggtgggggcggcgaggggcctggtgtacctgcacgagcagtgcgac
cccaagatcatccaccgcgacgtcaaggccgccaacgtgctgctggacgaggcgtgcgag
gccgtcgtcggcgacttcgggctggccaagctgctggaccaccgggagtcgcacgtcacc
acggcggtgcggggcaccgtcggccacatcgcgccggagtacctgtccacggggcagtcg
tcggaccggaccgacgtcttcggcttcggcatcctgctgctggagctcgtcaccggccag
acggcgctcgagttcggcaagtcgtccaaccacaagggcgccatgctggactgggtgaag
aagatgcagtcggagaagaaggtggaggtgctggtggacaaggggttaggcggagggtac
gaccgggtggaggtggaggagatggtgcaggtggctctcctctgcacccagtacctcccc
gcccaccgcccccgcatgtccgacgtcgtccgcatgctcgagggcgacggcctcgccgac
cgctgggagaaggcctccggccactccaccgccgccgccgactccctctcccactcccac
cgcacctcagacccggcgccgcccgccgccgacttcgccgccgccttcggccgctgcttc
tccgacctcaccgacgactcctccctcctcgtccaggccgtcgagctctccggccccaga
taa

Protein

641 aa

>Os06t0274500-01 Similar to SERK1 (Fragment).
MEPPFFLLLLLLVVSSSSPSAALLSAKGVNNEVQALIVIKNLLKDPHGVLKSWDQNSVDP
CSWAMITCSPDFLVTGLEAPSQHLSGLLSPSIGNLTNLETVLLQNNNITGPIPAEIGRLE
NLKTLDLSSNSFYGEIPSSVGHLESLQYLRLNNNTLSGPFPSASANLSHLVFLDLSYNNL
SGPIPESLARTYNIVGNPLICDANREQDCYGTAPMPMSYSLNGSRGGALPPAARDRGHKF
AVAFGSTAGCMGLLLLAAGFLFWWRHRRNRQILFDVDEQQIENVNLGNVKRFSFRELQAA
TEGFSGKNILGKGGFGNVYRGQLPDGTLVAVKRLKDGNAAGGEAQFQTEVEMISLALHRN
LLRLYGFCMTATERLLVYPFMSNGSVASRLKAKPALEWGTRRRIAVGAARGLVYLHEQCD
PKIIHRDVKAANVLLDEACEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQS
SDRTDVFGFGILLLELVTGQTALEFGKSSNHKGAMLDWVKKMQSEKKVEVLVDKGLGGGY
DRVEVEEMVQVALLCTQYLPAHRPRMSDVVRMLEGDGLADRWEKASGHSTAAADSLSHSH
RTSDPAPPAADFAAAFGRCFSDLTDDSSLLVQAVELSGPR*

5'UTR

chr06:9315991..9316157 (+ strand) : 167 bp

CDS

chr06:9316158..9316254 (+ strand) : 97 bp

chr06:9316357..9316489 (+ strand) : 133 bp

chr06:9316591..9316662 (+ strand) : 72 bp

chr06:9316776..9316919 (+ strand) : 144 bp

chr06:9317133..9317204 (+ strand) : 72 bp

chr06:9317402..9317461 (+ strand) : 60 bp

chr06:9317567..9317820 (+ strand) : 254 bp

chr06:9319123..9319464 (+ strand) : 342 bp

chr06:9321184..9321563 (+ strand) : 380 bp

chr06:9323050..9323418 (+ strand) : 369 bp

3'UTR

chr06:9323419..9323826 (+ strand) : 408 bp

FASTA

>Os06t0274500-01 class=Sequence position=chr06:9315991..9323826 (+ strand)
GTTAGTTCGA GCGCACACAC ACAATCACAC ATTGCACGCG CAGACGCAGC CACTGCTTCT TCTTCCTCCT CTTCTCCCAG
GAAAGAGCTC ACCTGACCTG ACCACCTGAG GTTGTAGTTG CTGGTTTGCT TGCTAGCTTC GTCGTCTCCT CCTACCTGAG
CTCAGCAATG GAGCCGCCCT TCTTCCTCCT CCTGCTGCTG CTCGTGGTCT CCTCCTCCTC CCCTTCCGCC GCCCTCCTCT
CCGCCAAGGG CGTCAACAAC GAAGGTAAGG TTCAGTTCAG TTCATCCCTT CCTCTCTCTT GTTTCCTCTG ATCGTTTCTT
GCATTTGGGC GTGTGCTGAT TGATTGATTG GCTGGTTGAT TGGCAGTGCA AGCTCTGATT GTGATCAAGA ACCTGCTCAA
GGACCCCCAT GGCGTGCTCA AGAGCTGGGA CCAGAACTCC GTCGACCCCT GCAGCTGGGC CATGATCACC TGCTCCCCGG
ATTTCCTCGT CACTGGCCTG TATGTTAGCT CTCACCTTCC ATTGCTTCAC AGTATCAATC TCAATCTCAC CTCTCTTCTC
TTCTCTGCTG CTTGTCTGAA TACTCTGAAT GTTTTTTCAG GGAAGCTCCA AGCCAGCATC TCTCTGGCCT GCTCTCACCA
AGCATCGGCA ACCTGACCAA TCTTGAGACT GTGTCAGTAG TGTTCTTTCT TCTTCTTCTA CTTCACATCA ATCCATAGCC
TTATCATGGT CAGTTCTTGT ACTTAAACAG AGTGTCTCTT TTCTTTGATG TGCTGGTGGG TGCAGTCTCC TGCAGAACAA
CAACATAACC GGGCCAATCC CAGCAGAGAT TGGCAGGCTG GAGAACCTCA AGACGCTTGA TCTCTCCAGC AACAGCTTCT
ATGGCGAAAT CCCCAGCTCT GTGGGCCACC TCGAGAGCCT CCAGTACTTG TGAGTCGAGA GCTCCACTGT TCAAAGCCTC
TGAATACTGT TCCATTTATT TTGTAGTAAA GATAATTATA AGCACACTGT TCTTGATTAT GATATCTAGA TATGTAGCAG
TATCATATCA TATCTACACA TAGTTATTGT GGTTGTTCTC CGTTTTTTTG TTGCCATGTT AATTAAGTTT GAGTTAACTC
TGTTGCTGTG AAATTTGATC AGGAGGCTCA ACAACAACAC CCTGTCTGGT CCATTCCCTT CTGCATCAGC TAACCTGTCA
CACCTTGTTT TCCTGTGAGT AAATTCATCT CAGTTTTGGG TTGTTGCAAT TAAACAGTTC GATTTTGTCT CAACCTGCTT
ACTTGTGTCA TTTATTCAGA GATGCTTTGT CTTGCCCTGC TCTTTCTTGA GCTATATTAA CTTATTCTTT TAAGTGTACT
ATTCAGTTTG GTTTGTCTCA TCACTCTGCA TACACTCGTG TTCTTCTTCA GAGATTTGTC ATATAACAAC CTGAGTGGCC
CGATTCCAGA ATCATTGGCA AGAACTTACA AGTAAGGCTG CAGTTTCAAG TTCATCAATT CTTCCAACAA GAAGAAAAAA
AATCTTCCAA TTTTTTTTGG TTCATCAACA ATTGCATGGT TTTTTTTTTC TTGCAGCATA GTGGGGAATC CCCTCATCTG
CGACGCCAAC AGGGAGCAGG ATTGCTACGG GACGGCGCCG ATGCCGATGA GCTACAGCCT GAACGGCTCG CGGGGCGGCG
CGCTGCCGCC GGCGGCGAGG GACAGGGGGC ACAAGTTCGC CGTCGCGTTC GGCTCCACCG CCGGCTGCAT GGGCCTCCTC
CTCCTCGCCG CCGGTTTCCT CTTCTGGTGG CGCCACCGCC GCAACCGGCA GATCCTCTTT GACGTCGACG GTAAACCTCA
GTCTTTTCTC GCAGCTAACC TACCTGCATT TCATCATCCA TAATTCTTAG AGAAATTATT TTCAGGCCTT TGTCTAGAGT
Tttattgtgg attatttgct ccacgcttct ttaaaaaaac gatttttcgt aaaaaaaaga ctatttattc taAGCTTTTT
GGTACCTTGT AATACCTTAA TTTTACGCTA GGGCCTTCTT CGAAGtaggg atgaaaatgg agcggatagt ttccgtccgc
tccggacaaa aacggatacg gatacctttc ggatcggata attctcggat atttcggata cggatacgaa tacggatatt
ttctcccgga tacgaatacg aatatggtat caggtttccg ccggatacgg ataataattc ggatatccgg tgaacagtgc
tattcggata tccgcaggac ccatgagaca taccctattt ctttctaact ctataacctt caatatacct ttatagattt
taatagtagt ttatctctta acactagtcc atactattaa tattatttaa attttaaaaa atatttataa attatacctc
attttatata aaatgagcta attatatatg ttgatattta tttctattag aagttgagtt ggttttcgtg ttccgagaaa
aatttgtttc cgtattcgtg tccgatcata ttcgattctt attcgtattc gagataatcc gtatttgttt ccgtattcgt
tttcgtatcc ggtaaaaaat atgaaaacga atatggtatg aacattatcc atccgtatcc gctccgtttt catccataCT
TCGAAGTCGA TGGTAACCTC AATCTTTTTC CAAAACAACC TGCATTTCGT CATTAATTCC AAGAGAAATT ATTGTCAGCT
TTTGTCTAAg atttttggta cggattattc gctccatgct tcttagattt ttttttaaaa aaaacttctg ctgtcatatt
cacctgttct aaactattgt gaagtttatt tctcaaaata ttgatttatt gtgttaaata agtataaaaa atctgcctca
ataattcacg caaaaatcGT ATTTCAAATA GGGTGTACAC AACATTTTAA TATAAAATTT GATATCTCAT GACATCTGAA
TAATAAAAAC CCACCAACAT TCACGCTAGT GGTACCTTCC AAAGGACCAT AAATTAAATC ACTCCAATTT TGAATTCAGA
CAAGGGGTAT TACATCTCTA ATAAATTTGA GTATTAATGT TAATAGACTA GTGTTGTTGG TTTTGGTTGG GAAAAAAAAT
AAAAAATTGC AGAGCAGCAG ATTGAGAACG TGAACCTGGG GAACGTGAAG AGGTTCAGCT TCAGGGAGCT GCAGGCGGCG
ACGGAGGGGT TCAGCGGGAA GAACATCCTG GGGAAAGGAG GGTTCGGGAA CGTGTACAGG GGGCAGCTCC CCGACGGGAC
GCTGGTGGCG GTGAAGCGGC TCAAGGACGG CAACGCGGCC GGCGGCGAGG CCCAGTTCCA GACGGAGGTG GAGATGATCA
GCCTCGCCCT CCACCGCAAC CTCCTCCGCC TCTACGGCTT CTGCATGACC GCCACCGAGC GCCTCCTAGT CTACCCCTTC
ATGTCCAACG GCAGCGTCGC CTCCCGCCTC AAAGGTAACC AAACCAAATT CGTAAATTAA TATTTCTAGT ACTGTATCTA
TTTTTCTTCT TAAGATTATG AATTGCTCTT TTTTAtccta aaatatataa caatccagta cgagatgaga tacatcataa
taatatgaat tcaaacagat tttctgttta gattcgtgat gttaggatat gtctcatctc agtactaagt tgctatattt
tACtctctct attttaaaac aaagtaaaat agtacgagat gcgatacatt ataatactat aaattgaaac aGACATTATG
TTCAGATTTG AAGTATTATG ATATATCACA TCTACTACTA GAATTCTATA TTTTAAGAga taaattttac catttttgag
aggtatgaaa atgtaccaaa atttattgca aatttccgta actcctaggt atatatacca aattttacac tgaaaaatat
agtacatctc aatatctcat taagaacagt aaaataactc atTTTGAGAG AGAGGCAGTA CAAGATTCAG ACAATGACCA
CGGAGAAAGT CCGGTAGAAT TCCTCCAATC TGCTGCAGCT CGAATGTTCT TTACTCGATA TGACAGCAGA AATCTGAGTG
GAACAGCAGC AGCAGCATAT GTTCTTTGCT GGATTTTTCA TATCATACCG GACCTAAAAG AGAGGTGCAG AATCGAAAGA
CTGAAGCTTT CAGTTCAGGC CGGCAAAGAA ACAAGTGGAG CATGATAAGA GCTCGGAATT GGATTCCATT GCCCTGAAAG
ATAATTAAAA AAAGGAGACT AAATTTATCT ATCACGACGA GAAGAGAAGA AGAGGAGAAT GTGATTCCCA ATCAGACACA
AAAAAAACTC CAGCTTTATT CCTTCCTTTC CGACTGCACT CACCCACTTT GAATCTCTGA CCAAATGATG ATGATGAATT
GATGTGGTTT CCCTTTCAAA ATTAACTTGC AAACAAATTG TGACGACGAC AGACGCCATT GATGTGCTTC CGTTCGCTGA
GGGAGCTAGG ATGTGATTCT CAATTAGATA CAACCAAAAA AAAAAGAAAA ATCTTTGGTT TATTCCTTCC TGTCCGAACT
CTGAAACTCT GAATTCTCTG ACCAAATGAC GGTGATCGGT GCATGAACAG CGAAGCCGCC GGTTTCAATC CCTGAAGTAG
AATGTGATTC TCAATCAGAC ACAAACAAAC ACAAAAAAGT TCTTTCCTTT ATACCTTTCT GTCCGAATCA CTCCCTCAAT
CTGAAACTCT GAATTTCTCT GACCAAATGA TGGTGATCGG CGCCTGAACA GCGAAACTGC TGGTTTCTTT TTtttttttt
tcgaacggtc ggaccgttgc caacgtttta tattaagaag aagatatccc attttaagga gaaaacagga tcaaacctta
caatgctcag ttaattaggg aaaactgagc gaaaaccaca gctacaaCAC CACACCAACA GCTAACCTAA CTTAAGCTAC
CACGACGGAG CCCGAAAAAC CGCCGGTTTC AATCCCTGAA GTAGAGTGTG ATACCCAATT AGACACAAAC CAACACCAAA
AATCTTTACC TTATACCTTT CACTCCCTCA CTCACTCTGA AACTCTGAAA CTCTGACCAA ATGATGAATG ATGACGATGA
TGAACTGACG ACGCGGTTCC AAAAACTAAC CTGGGCAGAT TAATGAAACA TGCTACTata aaatcgcatg cagcgaagcc
ggcgttggag tgggggacga ggaggaggat cgcggtgggg gcggcgaggg gcctggtgta cctgcacgag cagtgcgacc
ccaagatcat ccaccgcgac gtcaaggccg ccaacgtgct gctggacgag gcgtgcgagg ccgtcgtcgg cgacttcggg
ctggccaagc tgctggacca ccgggagtcg cacgtcacca cggcggtgcg gggcaccgtc ggccacatcg cgccggagta
cctgtccacg gggcagtcgt cggaccggac cgacgtcttc ggcttcggca tcctgctgct ggagctcgtc accggccaga
cggcgctcga gttcggcaag tcgtccaacc acaagggcgc catgctggac tgggtaagTA TTATTTTATA CTATTATTAA
TTCATTCGTC AATTCGTTTG ATTGATTGAT TGATTAGCTT GTGCAATCTC GAGtactccc tctgtcccat aatacaaggg
attttaagtt tttgtttgca ctgtttgacc actcgtctta ttcaataaat tttggaatta ttttttttac ttactttatt
atcccaagta ctttaagcat aactttttgc tttttatatt tgcataaatt ttttgaataa gatgagtggt caaacaatac
aaacaaaaac ttaaaatccc ttgtattatg tgatGGAGGG AGTAGTATAA TTCTAATCGG TAGAAACACC TTCAAATTTA
AGGGCGCCAT GCTGGACTGG GTAAATATAT GTGCTACTGA TTTCAATTCG ATCCGTTAAT TCGTTTGATC GATTAGCTTG
TGCAATCTGG AGTAGTATAA TTCTAATCGG TAGAAACACC TTAAGATtac tccctccatt ttatattatg aattgatttg
atctttttta agtcgaactt caatttgatc aagtttatgt aaaaacaaag tagcattttg aacactgcac aaatatattt
gtcaaattgt atttaatgtt agatttaata aaattgattt ggtattttag atgttgctaa ttttttctat taatttaatc
aaacttaaca aaatttgact agaaaaagag ttaaagcgac ttataataca aaacggatga agtaATTAAG AGTTAGAAGA
TGACACTAAT ACTTTCCAAA ATTCTAAAAA AAATTGAGAA TGTGTGATAT ATTAGGAAAT TGCTAAAAGA TTGTCACAAG
TTCTTTTTGT TAAAAAACTT TCAAATGTAA CTATTCAAGT ATTATACCTT ATTTCATTCT AGATGCTGCA ACATTAAATT
CAATCTAGGC ATGGAGAAAA ATAAAATCTC GGCTAGGAAA AACGCGGAAC TATTCGCAAC TTGATTTTGT TTTTTTCTCT
CAGATTGAAT TTTAGCCTCG CATTTTCAAT ACATTTTTTA GAGTGAAGTT CAGCACCACA ATATATGTAC TTAATTTTTT
TAGATTGTTT TACTCATTTT TATAGGGAAA TTTGTAAAAA TAATATTCAC TGAAATTTTT CATAACTATT CGAATAATCC
CCATGTAAAC CGATCAATCA CAAAACTAAG ATCAGCGGTG TGCTTTTCTA TCGAAGATAA AAGATGAAGT TACGGTacac
gaaataaaaa accatttact cctgattaat taagtttcag ttattacaaa cttaaaaaat agatttattt gatattttaa
aataactaat atatatataa ttttcacacg aaacctacca tttaacagtt ttaaaaatgt gctaacaaaa atgaaagtaa
aatCTACATC TTAATCCGAA CACCACCAAA TGTGATTGTG TGTTGTTGAG GGCATAATGT AGAGAAACTG TGACGATGAT
GCAAAGAAAA AAAATGcagg tgaagaagat gcagtcggag aagaaggtgg aggtgctggt ggacaagggg ttaggcggag
ggtacgaccg ggtggaggtg gaggagatgg tgcaggtggc tctcctctgc acccagtacc tccccgccca ccgcccccgc
atgtccgacg tcgtccgcat gctcgagggc gacggcctcg ccgaccgctg ggagaaggcc tccggccact ccaccgccgc
cgccgactcc ctctcccact cccaccgcac ctcagacccg gcgccgcccg ccgccgactt cgccgccgcc ttcggccgct
gcttctccga cctcaccgac gactcctccc tcctcgtcca ggccgtcgag ctctccggcc ccagataaca ccaccaTGAT
CGAGTAGCTG TGGTGTGTGG CTCTTCTTGT ACAGCATGCT TGCATGGAGC TCTCTGTCTT TCTGTCTGAA TATTAATGTA
GCTAGCTAGG TTGGGAAAta cttccctgtt tcatattata aaacttttta gcattaccca tacattcata tatatatgtt
aataaatcta gatatatatg tatgcctaga tttattaaca tctatatgaa tgaatgtggg caatgctaga aagttttata
acctgaaatg gaggtagtaA TAATTATATT TTACTAAGGT AATTACTAAT TAGTGATGCG TATATATTTA TATCATTTTA
GATGAACTGT ACAAACACAA GAGGAGAGGA CAAGGACTTG TACTTTTCCG TGTCTCCATA TATACTTGAT GTTAAT

Locus: Os06g0274500

Loading...

Locus: Os06g0274500

Loading...