Os06t0275000-01

Locus

Os06g0275000

Description

Zinc finger protein, Heading date

RAP-DB Gene Symbol Synonym(s)

SE1, Se1(Lm,Lf,Rs,Fl), se(t), Hd1, HD1, Fl, Lm, Se1, K, Rs, Lf, Se-1, Hd1(t), qHD1(t), OsA, OsBBX18, Hd1/OsA, OsCCT21

RAP-DB Gene Name Synonym(s)

PHOTOSENSITIVITY 1, Photosensitivity1, Photosensitivity 1, Photoperiod sensitivity 1, Heading date, Photoperiod-sensitivity-1, HEADING DATE 1, Arabidopsis CONSTANS(CO) gene ortholog, ortholog of Arabidopsis CONSTANS, B-box-containing protein 18, CCT domain-containing gene 21, CCT (CO, CO-LIKE and TOC1) domain protein 21, CCT domain protein 21

CGSNL Gene Symbol

SE1

CGSNL Gene Name

PHOTOSENSITIVITY 1

Oryzabase Gene Symbol Synonym(s)

Se1(Lm,Lf,Rs,Fl), se(t), Hd1, HD1, Fl, Lm, Se1, K, Rs, Lf, Se-1, Hd1(t), qHD1(t), OsA, OsBBX18, BBX18, Hd1/OsA, OsCCT21, CCT21

Oryzabase Gene Name Synonym(s)

Photosensitivity1, Photosensitivity 1, Photoperiod sensitivity 1, Heading date, Photoperiod-sensitivity-1, HEADING DATE 1, Arabidopsis CONSTANS(CO) gene ortholog, ortholog of Arabidopsis CONSTANS, B-box-containing protein 18, CCT domain-containing gene 21, CCT (CO, CO-LIKE and TOC1) domain protein 21, CCT domain protein 21

Transcript Evidence

AB041838 (Genbank)

Protein Evidence

Q9FDX8 (UniProt)

Literature

PMID: 11148291

Note

Manual Curation

May 8, 2009

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, B-box (IPR000315)

CCT domain (IPR010402)

Expression Databases

TENOR (Os06t0275000-01)

RiceXPro (AB041838)

Others

Oryzabase (760)

KEGG (Os06t0275000-01)

Transcript

1557 bp

>Os06t0275000-01 Zinc finger protein, Heading date
CAAAATTCCACAAGAGCCATGCGAGGTAGAGGAACAGGAGAAGACGCATACACACACGAC
ACATAGAGAGAGAGGACAAACACAATAGCTTGGATCGATAGACTTGTCCATGTGGTGCAA
GCTAAAGCTACTACTACCACAAGCAAGGCTACTTCGTTCATGAATTATAATTTTGGTGGC
AACGTGTTCGACCAGGAGGTTGGAGTTGGAGGCGAAGGAGGAGGAGGAGGAGAGGGGAGC
GGCTGCCCATGGGCGCGGCCGTGCGACGGGTGCCGCGCGGCGCCGAGCGTGGTGTACTGC
CGCGCGGACGCGGCGTACCTGTGCGCGTCGTGCGACGCGCGGGTGCACGCGGCCAACCGC
GTGGCGTCCCGCCACGAGCGCGTGCGGGTGTGCGAGGCCTGCGAGCGCGCCCCGGCCGCG
CTCGCGTGCCGCGCCGACGCCGCCGCGCTGTGCGTGGCGTGCGACGTGCAGGTGCACTCC
GCGAACCCGCTCCCGGCCATCACCATCCCGGCCACCTCCGTCCTCGCTGAGGCGGTGGTG
GCCACCGCCACCGTCCTCGGCGACAAGGACGAGGAGGTGGACTCTTGGCTTCTCCTCTCC
AAAGATTCCGACAACAACAACAACAATAACAACAACAACGACAACGACAATAACGACAAC
AACAACAGCAACAGCAGCAACAACGGCATGTATTTTGGTGAAGTCGATGAGTACTTTGAT
CTTGTCGGGTACAATTCGTACTACGACAACCGCATCGAAAACAACCAAGATCGGCAGTAT
GGGATGCATGAACAGCAAGAGCAGCAGCAGCAGCAGCAGGAGATGCAAAAGGAGTTTGCA
GAGAAGGAAGGGAGCGAGTGTGTGGTACCTTCACAGATCACAATGCTGAGTGAGCAGCAG
CATAGTGGTTATGGAGTTGTGGGAGCAGACCAGGCCGCCTCCATGACCGCCGGCGTCAGT
GCTTACACAGATTCCATCAGCAACAGCATATCTTTCTCATCAATGGAGGCGGGTATAGTA
CCAGACAGCACGGTGATAGATATGCCAAATTCCAGAATCCTGACACCTGCTGGAGCAATC
AATCTCTTCTCAGGTCCCTCGCTTCAGATGTCCCTTCACTTCAGCTCCATGGACAGGGAG
GCCAGGGTGCTCAGGTACAGGGAGAAGAAGAAGGCCAGGAAGTTTGAGAAGACAATACGT
TATGAAACAAGAAAGGCGTATGCAGAGGCACGACCCCGGATCAAGGGCCGTTTCGCCAAG
AGATCAGATGTGCAGATCGAAGTGGACCAGATGTTCTCCACTGCAGCTCTATCTGACGGT
AGCTATGGTACTGTTCCATGGTTCTGATGGGACTCATGAGACGCTATCTTATAGGCATAT
ATATGGGGACTTACTGAGTAGCAATAACATCGATCCAGTGGGAGTAGTTCTAGACAATCT
GTGTTATGAATAATAGTGTGTTGTTTGCGACTTAAAATTGATCAAGTACCTTAGCTTTTT
AAAGTTTTGCTTTGTAATTTCCGGATAGCAGATATATATTGTTGGTACTTGCTCAGT

CDS

1188 bp

>Os06t0275000-01 Zinc finger protein, Heading date
ATGAATTATAATTTTGGTGGCAACGTGTTCGACCAGGAGGTTGGAGTTGGAGGCGAAGGA
GGAGGAGGAGGAGAGGGGAGCGGCTGCCCATGGGCGCGGCCGTGCGACGGGTGCCGCGCG
GCGCCGAGCGTGGTGTACTGCCGCGCGGACGCGGCGTACCTGTGCGCGTCGTGCGACGCG
CGGGTGCACGCGGCCAACCGCGTGGCGTCCCGCCACGAGCGCGTGCGGGTGTGCGAGGCC
TGCGAGCGCGCCCCGGCCGCGCTCGCGTGCCGCGCCGACGCCGCCGCGCTGTGCGTGGCG
TGCGACGTGCAGGTGCACTCCGCGAACCCGCTCCCGGCCATCACCATCCCGGCCACCTCC
GTCCTCGCTGAGGCGGTGGTGGCCACCGCCACCGTCCTCGGCGACAAGGACGAGGAGGTG
GACTCTTGGCTTCTCCTCTCCAAAGATTCCGACAACAACAACAACAATAACAACAACAAC
GACAACGACAATAACGACAACAACAACAGCAACAGCAGCAACAACGGCATGTATTTTGGT
GAAGTCGATGAGTACTTTGATCTTGTCGGGTACAATTCGTACTACGACAACCGCATCGAA
AACAACCAAGATCGGCAGTATGGGATGCATGAACAGCAAGAGCAGCAGCAGCAGCAGCAG
GAGATGCAAAAGGAGTTTGCAGAGAAGGAAGGGAGCGAGTGTGTGGTACCTTCACAGATC
ACAATGCTGAGTGAGCAGCAGCATAGTGGTTATGGAGTTGTGGGAGCAGACCAGGCCGCC
TCCATGACCGCCGGCGTCAGTGCTTACACAGATTCCATCAGCAACAGCATATCTTTCTCA
TCAATGGAGGCGGGTATAGTACCAGACAGCACGGTGATAGATATGCCAAATTCCAGAATC
CTGACACCTGCTGGAGCAATCAATCTCTTCTCAGGTCCCTCGCTTCAGATGTCCCTTCAC
TTCAGCTCCATGGACAGGGAGGCCAGGGTGCTCAGGTACAGGGAGAAGAAGAAGGCCAGG
AAGTTTGAGAAGACAATACGTTATGAAACAAGAAAGGCGTATGCAGAGGCACGACCCCGG
ATCAAGGGCCGTTTCGCCAAGAGATCAGATGTGCAGATCGAAGTGGACCAGATGTTCTCC
ACTGCAGCTCTATCTGACGGTAGCTATGGTACTGTTCCATGGTTCTGA

Protein

396 aa

>Os06t0275000-01 Zinc finger protein, Heading date
MNYNFGGNVFDQEVGVGGEGGGGGEGSGCPWARPCDGCRAAPSVVYCRADAAYLCASCDA
RVHAANRVASRHERVRVCEACERAPAALACRADAAALCVACDVQVHSANPLPAITIPATS
VLAEAVVATATVLGDKDEEVDSWLLLSKDSDNNNNNNNNNDNDNNDNNNSNSSNNGMYFG
EVDEYFDLVGYNSYYDNRIENNQDRQYGMHEQQEQQQQQQEMQKEFAEKEGSECVVPSQI
TMLSEQQHSGYGVVGADQAASMTAGVSAYTDSISNSISFSSMEAGIVPDSTVIDMPNSRI
LTPAGAINLFSGPSLQMSLHFSSMDREARVLRYREKKKARKFEKTIRYETRKAYAEARPR
IKGRFAKRSDVQIEVDQMFSTAALSDGSYGTVPWF*

5'UTR

chr06:9336376..9336534 (+ strand) : 159 bp

CDS

chr06:9336535..9337362 (+ strand) : 828 bp

chr06:9338000..9338359 (+ strand) : 360 bp

3'UTR

chr06:9338360..9338569 (+ strand) : 210 bp

FASTA

>Os06t0275000-01 class=Sequence position=chr06:9336376..9338569 (+ strand)
CAAAATTCCA CAAGAGCCAT GCGAGGTAGA GGAACAGGAG AAGACGCATA CACACACGAC ACATAGAGAG AGAGGACAAA
CACAATAGCT TGGATCGATA GACTTGTCCA TGTGGTGCAA GCTAAAGCTA CTACTACCAC AAGCAAGGCT ACTTCGTTCA
TGAATTATAA TTTTGGTGGC AACGTGTTCG ACCAGGAGGT TGGAGTTGGA GGCGAAGGAG GAGGAGGAGG AGAGGGGAGC
GGCTGCCCAT GGGCGCGGCC GTGCGACGGG TGCCGCGCGG CGCCGAGCGT GGTGTACTGC CGCGCGGACG CGGCGTACCT
GTGCGCGTCG TGCGACGCGC GGGTGCACGC GGCCAACCGC GTGGCGTCCC GCCACGAGCG CGTGCGGGTG TGCGAGGCCT
GCGAGCGCGC CCCGGCCGCG CTCGCGTGCC GCGCCGACGC CGCCGCGCTG TGCGTGGCGT GCGACGTGCA GGTGCACTCC
GCGAACCCGC TCCCGGCCAT CACCATCCCG GCCACCTCCG TCCTCGCTGA GGCGGTGGTG GCCACCGCCA CCGTCCTCGG
CGACAAGGAC GAGGAGGTGG ACTCTTGGCT TCTCCTCTCC AAAGATTCCG ACAACAACAA CAACAATAAC AACAACAACG
ACAACGACAA TAACGACAAC AACAACAGCA ACAGCAGCAA CAACGGCATG TATTTTGGTG AAGTCGATGA GTACTTTGAT
CTTGTCGGGT ACAATTCGTA CTACGACAAC CGCATCGAAA ACAACCAAGA TCGGCAGTAT GGGATGCATG AACAGCAAGA
GCAGCAGCAG CAGCAGCAGG AGATGCAAAA GGAGTTTGCA GAGAAGGAAG GGAGCGAGTG TGTGGTACCT TCACAGATCA
CAATGCTGAG TGAGCAGCAG CATAGTGGTT ATGGAGTTGT GGGAGCAGAC CAGGCCGCCT CCATGACCGC CGGCGTCAGT
GCTTACACAG ATTCCATCAG CAACAGCGTG AGTTCATCTA TTACTAGCTG CAACTATTTT TTTTTCAGAG AATGAACATC
TATTACTGTT GTTAGTTAGT TGTTACTACA TGCCACGTTG TCAATGTTTT AGAGTTCATA CTAGTACTTT TGAGTGGAAA
AACATTCTCC AAACAAAAGC TACTGTCTAA CAAAATGAAG GGATAAATAA ACAGATCTCA ACAAGAAAAC AAAGATACTT
TTCTACTTCC AAGCTGCGAT CTTTAGGCTG ATTAAATGGA ACCGATAAAA AAAATACTTT AAAGAAAAGT ACACAATTGA
TCTTTAGGCA GACCAGTTGA CTACTTCCTG TATTTCTAAG CATATACGAT CCATGCTAAC TCACTAATTG AAAAGAAGTG
AGTTTGTTAA CCTTTTATGT ACACAGCAAT CACCACACGA AAGACCTCAT GAAAAGTAGG ATAAGTGTAA GTGTAATTCA
TATTTTATCC CAGTGCATAA ATTTAAAATA TCTTACTTTT GCGACAGTAA AAAAGATATT GGAAGTTTTT CTTATGTATG
TAAAATTAAA TTAAGCCCAT CTATATATCA TTGCAGGGTC TCTGACACCT GCAATCTCCT TATGATTCGC ATATTTCAGT
GACCATTTGC CGATTCCATC TCAGATATCT TTCTCATCAA TGGAGGCGGG TATAGTACCA GACAGCACGG TGATAGATAT
GCCAAATTCC AGAATCCTGA CACCTGCTGG AGCAATCAAT CTCTTCTCAG GTCCCTCGCT TCAGATGTCC CTTCACTTCA
GCTCCATGGA CAGGGAGGCC AGGGTGCTCA GGTACAGGGA GAAGAAGAAG GCCAGGAAGT TTGAGAAGAC AATACGTTAT
GAAACAAGAA AGGCGTATGC AGAGGCACGA CCCCGGATCA AGGGCCGTTT CGCCAAGAGA TCAGATGTGC AGATCGAAGT
GGACCAGATG TTCTCCACTG CAGCTCTATC TGACGGTAGC TATGGTACTG TTCCATGGTT CTGATGGGAC TCATGAGACG
CTATCTTATA GGCATATATA TGGGGACTTA CTGAGTAGCA ATAACATCGA TCCAGTGGGA GTAGTTCTAG ACAATCTGTG
TTATGAATAA TAGTGTGTTG TTTGCGACTT AAAATTGATC AAGTACCTTA GCTTTTTAAA GTTTTGCTTT GTAATTTCCG
GATAGCAGAT ATATATTGTT GGTACTTGCT CAGT