Os06t0285200-01

Locus

Os06g0285200

Description

Nuclear Factor-Y (NF-Y) family of transcription factor, Control of heading, Regulation of reproductive growth and development

RAP-DB Gene Symbol Synonym(s)

OsNF-YB9, OsHAP3D

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3D

CGSNL Gene Name

HAP3D SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3D, OsEnS-83, OsNF-YB9, NF-YB9, NFYB9

Oryzabase Gene Name Synonym(s)

HAP3 subunit D, LEC1-type 3 subunit protein-D, endosperm-specific gene 83, NUCLEAR FACTOR-Y subunit B9, NUCLEAR FACTOR-Y subunit NF-YB9, HAP3 SUBUNIT D, NF-YB subunit 9, NF-YB family 9

Transcript Evidence

AK109660

Protein Evidence

Q5VNF4

Literature

PMID: 31482329

PMID: 18193457

Note

Manual Curation

September 10, 2019

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein heterodimerization activity (GO:0046982)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone domain (IPR003958)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737) [in the vicinity of the nucleus]

Full-length cDNA

002-141-E08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0285200-01)

RiceXPro (AK109660)

Others

Oryzabase (8483)

KEGG (Os06t0285200-01)

Transcript

924 bp

>Os06t0285200-01 Nuclear Factor-Y (NF-Y) family of transcription factor, Control of heading, Regulation of reproductive growth and development
GCAGCTTTTGGCAATGGAGCCCGCATTTCCCAACGGAGGTGCGGCTGCTCCACCACCGCC
CATGGCGGCGGAGCAGCTGCCGCCGGCGGCGGCGGTGGTCCGGGAGCAGGACCGCCTGAT
GCCGATCGCGAACGTGATCCGCATCATGCGGCGCGTGCTCCCGCCGCACGCCAAGATCTC
CGACGACGCCAAGGAGGTGATCCAGGAGTGCGTGTCGGAGTTCATCAGCTTCGTCACCGG
CGAGGCCAACGACCGGTGCCACCGCGAGCACCGCAAGACGGTCACCGCCGAGGACCTCGT
CTGGGCCATGGACCGCCTCGGCTTCGACGACTACGTCCCGCCGCTCACCGCCTACCTCCG
CCGCATGCGCGAGTACGAGGGCGGCGGATCAGGTGGTGGTGGTGGTGGTGGCCGTGGCGC
CGCCGCCGCCCCCGCCGTCGTGCCGCCGCCGCCGCCGCCGCCTCCCGAGGACGCGTTCCG
CTACGTGCAGGTCCATCATCCCGTGTACGCGGCGCCAGGTGAGCCGGTGCAGGGGTACGG
TTACCCCGTGGCCATGTCGTCTGCTCTGCCGGCGCCGCACGTGCACGTCGGCGTCCGCGG
CGGCGGGCAGCACGAGGTGTTCGGTGGCGGGCCGGCGCCCCTGGCTGTCTACTACGGAGG
AGCGccgtacggcgaggccagcagccgcggcggctgctctgccgccgacgaggggagctc
gtcgtcgagcgcctcgccggcgccggtcggccccaactatgagtaaaaacaaaagaagaA
GAAAATCAAACTCTTCCCCGGCTGACAGGTGATCGAGCTCGTCGTCTACAAATTATCAAT
CGTCTGTCGATCGATTAGCATGTAATCTAATAAAAAAACTTAAGCTAGCTTAAGACTTAA
TTAGACATGTTCTGTTCATCTTTC

CDS

753 bp

>Os06t0285200-01 Nuclear Factor-Y (NF-Y) family of transcription factor, Control of heading, Regulation of reproductive growth and development
ATGGAGCCCGCATTTCCCAACGGAGGTGCGGCTGCTCCACCACCGCCCATGGCGGCGGAG
CAGCTGCCGCCGGCGGCGGCGGTGGTCCGGGAGCAGGACCGCCTGATGCCGATCGCGAAC
GTGATCCGCATCATGCGGCGCGTGCTCCCGCCGCACGCCAAGATCTCCGACGACGCCAAG
GAGGTGATCCAGGAGTGCGTGTCGGAGTTCATCAGCTTCGTCACCGGCGAGGCCAACGAC
CGGTGCCACCGCGAGCACCGCAAGACGGTCACCGCCGAGGACCTCGTCTGGGCCATGGAC
CGCCTCGGCTTCGACGACTACGTCCCGCCGCTCACCGCCTACCTCCGCCGCATGCGCGAG
TACGAGGGCGGCGGATCAGGTGGTGGTGGTGGTGGTGGCCGTGGCGCCGCCGCCGCCCCC
GCCGTCGTGCCGCCGCCGCCGCCGCCGCCTCCCGAGGACGCGTTCCGCTACGTGCAGGTC
CATCATCCCGTGTACGCGGCGCCAGGTGAGCCGGTGCAGGGGTACGGTTACCCCGTGGCC
ATGTCGTCTGCTCTGCCGGCGCCGCACGTGCACGTCGGCGTCCGCGGCGGCGGGCAGCAC
GAGGTGTTCGGTGGCGGGCCGGCGCCCCTGGCTGTCTACTACGGAGGAGCGccgtacggc
gaggccagcagccgcggcggctgctctgccgccgacgaggggagctcgtcgtcgagcgcc
tcgccggcgccggtcggccccaactatgagtaa

Protein

251 aa

>Os06t0285200-01 Nuclear Factor-Y (NF-Y) family of transcription factor, Control of heading, Regulation of reproductive growth and development
MEPAFPNGGAAAPPPPMAAEQLPPAAAVVREQDRLMPIANVIRIMRRVLPPHAKISDDAK
EVIQECVSEFISFVTGEANDRCHREHRKTVTAEDLVWAMDRLGFDDYVPPLTAYLRRMRE
YEGGGSGGGGGGGRGAAAAPAVVPPPPPPPPEDAFRYVQVHHPVYAAPGEPVQGYGYPVA
MSSALPAPHVHVGVRGGGQHEVFGGGPAPLAVYYGGAPYGEASSRGGCSAADEGSSSSSA
SPAPVGPNYE*

5'UTR

chr06:10137823..10137835 (+ strand) : 13 bp

CDS

chr06:10137836..10138588 (+ strand) : 753 bp

3'UTR

chr06:10138589..10138746 (+ strand) : 158 bp

FASTA

>Os06t0285200-01 class=Sequence position=chr06:10137823..10138746 (+ strand)
GCAGCTTTTG GCAATGGAGC CCGCATTTCC CAACGGAGGT GCGGCTGCTC CACCACCGCC CATGGCGGCG GAGCAGCTGC
CGCCGGCGGC GGCGGTGGTC CGGGAGCAGG ACCGCCTGAT GCCGATCGCG AACGTGATCC GCATCATGCG GCGCGTGCTC
CCGCCGCACG CCAAGATCTC CGACGACGCC AAGGAGGTGA TCCAGGAGTG CGTGTCGGAG TTCATCAGCT TCGTCACCGG
CGAGGCCAAC GACCGGTGCC ACCGCGAGCA CCGCAAGACG GTCACCGCCG AGGACCTCGT CTGGGCCATG GACCGCCTCG
GCTTCGACGA CTACGTCCCG CCGCTCACCG CCTACCTCCG CCGCATGCGC GAGTACGAGG GCGGCGGATC AGGTGGTGGT
GGTGGTGGTG GCCGTGGCGC CGCCGCCGCC CCCGCCGTCG TGCCGCCGCC GCCGCCGCCG CCTCCCGAGG ACGCGTTCCG
CTACGTGCAG GTCCATCATC CCGTGTACGC GGCGCCAGGT GAGCCGGTGC AGGGGTACGG TTACCCCGTG GCCATGTCGT
CTGCTCTGCC GGCGCCGCAC GTGCACGTCG GCGTCCGCGG CGGCGGGCAG CACGAGGTGT TCGGTGGCGG GCCGGCGCCC
CTGGCTGTCT ACTACGGAGG AGCGccgtac ggcgaggcca gcagccgcgg cggctgctct gccgccgacg aggggagctc
gtcgtcgagc gcctcgccgg cgccggtcgg ccccaactat gagtaaaaac aaaagaagaA GAAAATCAAA CTCTTCCCCG
GCTGACAGGT GATCGAGCTC GTCGTCTACA AATTATCAAT CGTCTGTCGA TCGATTAGCA TGTAATCTAA TAAAAAAACT
TAAGCTAGCT TAAGACTTAA TTAGACATGT TCTGTTCATC TTTC

Locus: Os06g0285200

Loading...

Locus: Os06g0285200

Loading...