Os06t0302000-01

Locus

Os06g0302000

Description

Similar to BURP domain-containing protein 11.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBURP11

Oryzabase Gene Name Synonym(s)

BURP domain-containing protein 11

Transcript Evidence

AK106070 (DDBJ, Best hit)

Protein Evidence

Q5Z5C9 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-206-H06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0302000-01)

Others

Oryzabase (15050)

Transcript

1731 bp

>Os06t0302000-01 Similar to BURP domain-containing protein 11.
ATGAATATGAAAAGTCTGTACACATAGACAAAGAGGACCTCAAAGAAGTCTCAGTGTCAT
ATGGCTCAAATGTGAAACTAAGCAATTTGTTCCCAACAGGGTATGCACATCAGAAATATA
TATTAACAAGCGGAGCTGGACTAAAGGAAGTCTCCGTGACATATGGAAGTGATGGTGAAG
AGGAGCCAAGGAAAACATTCTCTAAAGTAGGGTATATGTTAGATAAGGAATGCAAGAAGT
CTTCAGATGTAGACGAAGGGGGACTAAAGGAAGTCTCGGTGTCATATGGAAGTAATGGTG
AAGAGGAGACCAGCAAAACCACTCCTATGGGAGGATACATGGTAGATATGAAAAACGAAA
AGTCTCTGCAAGCAGAGAAAGATGGACTAAAGGAAGTCTCGGTGTCATATGGAAGTAATG
GTGAAGAGGATACAAGCAAAACCTTTGCTATGGGAGGATACATGGTTGATAACGAACGTG
AAATGTCTCTACAAGGACAGAAAGTAATGATGAAGAGGAGACAAGAAAAATCATTCCTAT
GAAAGGATACATGGAAGACAGGGAACACGAAAAGTCCCTACAAGCGGAGAAAGAGGAACT
CAAAGAAGTTTCAGTGTCATATGGCCATGAAGTAAAACTAAGCAATTTGTTCCCTACGAG
ATTCGGACATAAGAATTATCAACACACATTCGAAGGAATGGATCATGGACGCCATGTTCA
CGCACACGGCAACAAGATGCAGCAACTGGCCGACGTCTTCTTCTTCCGCGACGCCCTCCG
GCCGGGCTCCGTCATCACGCCGACCATCCCGCCGACGACctcgctgccggccttcctccc
tcgccacgtcgccgacgccatcccgttctccgccgaccgctttgccgacgtcctcgccat
gttcgcgccggcgtccctcgccatggcgcgcgagatacggtgggcgctcgacacctgcgg
ccagcgggcggcggcgctgctcccgggcgagaaggccggctgcgccacctccctcgagtc
gctcgccgacctcgccgcgtcgctcctcgggacgcgcgacgtccgcgcgttctccgccgC
CGACCTTCCCACCGACGCCGCGACCACGCCGGCGCGGCGCGGGAGGTACAACGTGACGTC
CGTGCGGGAGCTCTCGGCGATGGCTGGTTCCGGTTCGTCGTCGTCGTCGGAGCCGGCGCC
GGCTGCCGTCGTGGCGTGCCACGACCTGACGTACCCGTACGCCGTGTTCTACTGCCACAG
TACCAAGCCGACCGCCGCGTACGCGGTGACGCTGGTGGCGGCGACCACCGGGGACGGCGA
CGGCGAAGGCGAGGCGGCCTCGCCGGCGAAGATGGAGGCGCTCGCCGTGTGCCACCTGGA
CACGTCGCGGTGGAGGGCGGACAACCCGTTCTTCGTGGCGCACGGCGTCAAGCCGGGGGA
GGTGTCCGTGTGCCACTTCCTCACCAAGCTCAGCATCGTCTGGGTCCCACGCCACGAGCA
GGGGGGCCCACGCGCAGCAGCTTAATCATCATCGATGATGTAAACAAGCTCTACAACCTA
AAGTGAACAATTTGGCGTGGTTTGTGCGTAATTTGCAGCAACGGTCGATCGAGCTATCTA
CTTATATAGTATGTAAAAAGTGAATAATTCAGTTTGTCATCGTGTGAACCACATGTGTGC
TGCATATTTGTGCGTGTGCATGTTCATAATTAATATGGATATTGTGTCTTC

CDS

540 bp

>Os06t0302000-01 Similar to BURP domain-containing protein 11.
GAATATGAAAAGTCTGTACACATAGACAAAGAGGACCTCAAAGAAGTCTCAGTGTCATAT
GGCTCAAATGTGAAACTAAGCAATTTGTTCCCAACAGGGTATGCACATCAGAAATATATA
TTAACAAGCGGAGCTGGACTAAAGGAAGTCTCCGTGACATATGGAAGTGATGGTGAAGAG
GAGCCAAGGAAAACATTCTCTAAAGTAGGGTATATGTTAGATAAGGAATGCAAGAAGTCT
TCAGATGTAGACGAAGGGGGACTAAAGGAAGTCTCGGTGTCATATGGAAGTAATGGTGAA
GAGGAGACCAGCAAAACCACTCCTATGGGAGGATACATGGTAGATATGAAAAACGAAAAG
TCTCTGCAAGCAGAGAAAGATGGACTAAAGGAAGTCTCGGTGTCATATGGAAGTAATGGT
GAAGAGGATACAAGCAAAACCTTTGCTATGGGAGGATACATGGTTGATAACGAACGTGAA
ATGTCTCTACAAGGACAGAAAGTAATGATGAAGAGGAGACAAGAAAAATCATTCCTATGA

Protein

180 aa

>Os06t0302000-01 Similar to BURP domain-containing protein 11.
EYEKSVHIDKEDLKEVSVSYGSNVKLSNLFPTGYAHQKYILTSGAGLKEVSVTYGSDGEE
EPRKTFSKVGYMLDKECKKSSDVDEGGLKEVSVSYGSNGEEETSKTTPMGGYMVDMKNEK
SLQAEKDGLKEVSVSYGSNGEEDTSKTFAMGGYMVDNEREMSLQGQKVMMKRRQEKSFL*

5'UTR

chr06:11314276..11314277 (+ strand) : 2 bp

CDS

chr06:11314278..11314308 (+ strand) : 31 bp

chr06:11314412..11314513 (+ strand) : 102 bp

chr06:11314613..11314735 (+ strand) : 123 bp

chr06:11315034..11315156 (+ strand) : 123 bp

chr06:11315452..11315574 (+ strand) : 123 bp

chr06:11315916..11315953 (+ strand) : 38 bp

3'UTR

chr06:11315954..11316004 (+ strand) : 51 bp

chr06:11316104..11316205 (+ strand) : 102 bp

chr06:11317453..11318488 (+ strand) : 1036 bp

FASTA

>Os06t0302000-01 class=Sequence position=chr06:11314276..11318488 (+ strand)
ATGAATATGA AAAGTCTGTA CACATAGACA AAGGTGAGAA TATTTGGAAG AACATTTGGC GTATTGTATT TTCGTAAAAG
TTGTTGACAT ATATAGATAA TATAAAAATA TTTTCTGTAT TGCCCGTAAA TTGTAGAGGA CCTCAAAGAA GTCTCAGTGT
CATATGGCTC AAATGTGAAA CTAAGCAATT TGTTCCCAAC AGGGTATGCA CATCAGAAAT ATATATTAAC AAGCGGAGGT
AACATTAGAA CTAGTGGATG CTCATGTTAC GTATATTGTG TGTATATGTT ATATACATGT ATATTTGAAA TTATAAAATG
GGCCATATGA GTTGCAGCTG GACTAAAGGA AGTCTCCGTG ACATATGGAA GTGATGGTGA AGAGGAGCCA AGGAAAACAT
TCTCTAAAGT AGGGTATATG TTAGATAAGG AATGCAAGAA GTCTTCAGAT GTAGACGAAG GTACAATATT TTGGAGTGCA
TTATGTATTT TGTATTTTTC TCTAGGTTGT TGACATATTC GGAAAAACTA AATAAATTGT TTCTACATGG ACCATGAACT
GTAGAGGAAC TCAGAGAAGT CTCAGTCTCA TATGGCCCAA AATTGAAACT AAACAATTAG TTCCCCACAG AACATAAGAA
ATATATATAC ACAAACGAAG ATAAGATTAT TTCGAACTAA AGGATGTTAG TGTAATGTAT TGTATGTCTC ATATAAATGT
ATATTGTAAA TAAAATAAAT TGGCCATATG GGCTGTAGGG GGACTAAAGG AAGTCTCGGT GTCATATGGA AGTAATGGTG
AAGAGGAGAC CAGCAAAACC ACTCCTATGG GAGGATACAT GGTAGATATG AAAAACGAAA AGTCTCTGCA AGCAGAGAAA
GGTGAGAACA GGATGTGTGC ACAATTCATG AATTAATATA TTGTTGACAT AATATAGAAA ACTAAATGAA TTGTTTCTAC
ATGGACTGCC AACTGTAGAG GAACTCAAAG AAGTTTCAGT GTCATACGGT TCAGATGTAA AACTAGGCAA TTTGTTCCCC
ATAGAACACA AGAAATATGT ATACAGAAAT GAAAGTGAGA TTATTTTGAA ACTAAAGGAG ATGTTAGTGC AATGTATTGT
ATGTCTTATA TAAATGTCTA TTGAAAATAA AAATAAATGA GCCATACGAG CTGCAGATGG ACTAAAGGAA GTCTCGGTGT
CATATGGAAG TAATGGTGAA GAGGATACAA GCAAAACCTT TGCTATGGGA GGATACATGG TTGATAACGA ACGTGAAATG
TCTCTACAAG GACAGAAAGG TGAGAATAGA AAGTATACTC ACAATTCATG AATTGTAGTT TTGTATACAT TGTTGACATA
ATATAGAAAA CCAAATAACC TGTTTCTACA TGCATGAGCT ACCAACTTTA GAGGAACTCA ATGACATTTC ATTGTCACAT
GGTCCAGATG TAAAACTAAA CATTTTGTTT TCCACATAAC ACAAGAAATA TATATATGCA AACAAATGTG AGATTATCTG
GGACTAAAAG ATGTTAGTGT AATGTATTCT ATGTAAGACA TAGATGTCTA CTGAAAATAA AAATAAATGG GCCATACAAG
TTGCATTGGG ACTAAAAGAA GTCTCGGTGT CATATGGAAG TAATGATGAA GAGGAGACAA GAAAAATCAT TCCTATGAAA
GGATACATGG AAGACAGGGA ACACGAAAAG TCCCTACAAG CGGAGAAAGG TGAGAATAGG AAGTATGCAT AAAATTGAAT
TGATAAGTAT ATTGTTGATA TAATACAGAA AACTAAATAA ATTGTCTCTA CATCGGCGTC AACTATAGAG GAACTCAAAG
AAGTTTCAGT GTCATATGGC CATGAAGTAA AACTAAGCAA TTTGTTCCCT ACGAGATTCG GACATAAGAA TTATCAACAC
ACATTCGAAG GTGAGAATAT TTGGAAATAG CAAGTTTGTC TGTTATACTT TCATATAACT TATGAATGCG TCTAGAAAAG
CAATTAGGGT ATTCATACTG TAAGTTGTTT TCCTTTGAAC CTTTTGTGTT TCCCTTAAAA TTGTCTAAGC ACGTACATTT
TGATAGAGCG ATGCTATTAC ATATCTCGGT TACCAAGAGA CACTAAATTT TATGTTAAAA ATATATTTGT CACCTCTCAC
CATCATCCAG GACTGTAAAA TTTCTCACCA TCATCCAGGA CTGTAAAATT TCTCATTTTG ATGACTTTCT TAATCTTGTA
TAGCCTATCG ATATATGCAT CGGCATATAT ATATATATAT ATATATATAT AGTTCACTAT GCTTGTAACT CAAAGATACA
AAGTGGATAA TTGTAATAAT AATAAAATAA ACATGGTTCA CCAATCTAGA AATTTCAACC ATTGGCGGAT CTTAATATAT
ACTCTTTCCT TGTCAAAATA TATATCTATC TTTGTATTTC AAATTTTTAC CTCTTAACCA CTTAAGAAAT GCATTTCCTT
AAGATcttat tcggtttaga ggggattaaa gaggattgga ggggattgag gaggaataat tccacaccac aatatgtgtg
gaataaatct cccccaatcc GTCCCTCACA GGGATTAACC AATCAAGGCC TAAGGGAGCT ACCAAAATTT ATCTCACAAG
TTATACTTTC AATTCTTTTT CAAACTCTCT GAGACATATA CATACATGTG TGAAACatta attttctttt tttttctttc
ttttctatat ggtatataag gatagaatga ttattttatt cataccgctg ttcgctgcat gcgaggatga cttggcatgc
tcacgtagca ccttttgtgg gtccaaggac tatattaacc caaatgatta atttgaaaga cttatttgaa cgatttgaaa
cctcaaggac taaactgagc tcgaagcgaa actataggga tcatattcac CCTAAAATAA ACATGGTTCA CCGGTCTAGA
AATTTCAAGC ATTGGCAGAT CTTAATACAT ACTCTTTCCA TGTTAAAATG TAGCTATCTT TGAATTTCAA ATTTTTACCT
CTTAACCACT TAAGAAATGC ATTTCCTTAA CGGAACTACC AAAATTTATC TCACAAGTTG TACTGCCAGT TCTTTCTCAA
ACTCTTTGAG GCGATATACA TACCTCTAGC TATTCTACGT TGTTGGTTCA TTCGCAGGAA TGGATCATGG ACGCCATGTT
CACGCACACG GCAACAAGAT GCAGCAACTG GCCGACGTCT TCTTCTTCCG CGACGCCCTC CGGCCGGGCT CCGTCATCAC
GCCGACCATC CCGCCGACGA Cctcgctgcc ggccttcctc cctcgccacg tcgccgacgc catcccgttc tccgccgacc
gctttgccga cgtcctcgcc atgttcgcgc cggcgtccct cgccatggcg cgcgagatac ggtgggcgct cgacacctgc
ggccagcggg cggcggcgct gctcccgggc gagaaggccg gctgcgccac ctccctcgag tcgctcgccg acctcgccgc
gtcgctcctc gggacgcgcg acgtccgcgc gttctccgcc gCCGACCTTC CCACCGACGC CGCGACCACG CCGGCGCGGC
GCGGGAGGTA CAACGTGACG TCCGTGCGGG AGCTCTCGGC GATGGCTGGT TCCGGTTCGT CGTCGTCGTC GGAGCCGGCG
CCGGCTGCCG TCGTGGCGTG CCACGACCTG ACGTACCCGT ACGCCGTGTT CTACTGCCAC AGTACCAAGC CGACCGCCGC
GTACGCGGTG ACGCTGGTGG CGGCGACCAC CGGGGACGGC GACGGCGAAG GCGAGGCGGC CTCGCCGGCG AAGATGGAGG
CGCTCGCCGT GTGCCACCTG GACACGTCGC GGTGGAGGGC GGACAACCCG TTCTTCGTGG CGCACGGCGT CAAGCCGGGG
GAGGTGTCCG TGTGCCACTT CCTCACCAAG CTCAGCATCG TCTGGGTCCC ACGCCACGAG CAGGGGGGCC CACGCGCAGC
AGCTTAATCA TCATCGATGA TGTAAACAAG CTCTACAACC TAAAGTGAAC AATTTGGCGT GGTTTGTGCG TAATTTGCAG
CAACGGTCGA TCGAGCTATC TACTTATATA GTATGTAAAA AGTGAATAAT TCAGTTTGTC ATCGTGTGAA CCACATGTGT
GCTGCATATT TGTGCGTGTG CATGTTCATA ATTAATATGG ATATTGTGTC TTC

Locus: Os06g0302000

Loading...

Locus: Os06g0302000

Loading...