Os06t0318500-00

Locus

Os06g0318500

Description

Similar to Sodium/hydrogen exchanger.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NHX4

CGSNL Gene Name

NA+/H+ ANTIPORTER 4

Oryzabase Gene Symbol Synonym(s)

OsNHX4

Oryzabase Gene Name Synonym(s)

Na+/H+ antiporter 4, NHX-type antiporter 4

Transcript Evidence

AK376115 (DDBJ)

Protein Evidence

A7X9Z5 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: sodium ion transport (GO:0006814)

Biological Process: regulation of pH (GO:0006885)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: solute:hydrogen antiporter activity (GO:0015299)

Molecular Function: sodium:hydrogen antiporter activity (GO:0015385)

Functional domain (InterPro)

Na+/H+ exchanger (IPR004709)

Cation/H+ exchanger (IPR006153)

Cation/H+ exchanger, CPA1 family (IPR018422)

Expression Databases

TENOR (Os06t0318500-00)

Others

Oryzabase (11247)

Transcript

1693 bp

>Os06t0318500-00 Similar to Sodium/hydrogen exchanger.
CGCAGCAGAGAGAACAGAGAGGGGAATGCGAGGATGGCGTGGTGGTGGTGGTGGTCGGAG
GCGGTGGTGGTGGGCGGAGGGACGGGCGGCGGGAGCAGCGGCACGGTGGTGTCCATCTGC
GTGTTCACGGCGGTGCTGTGCGTGTGCCTCGTCGCCGGCCACCTCCTCGAGGAGAACAAG
TGGGTCAACGAGTCCATCACCGCCCTCCTCATCGGTTGTGTTGTAGGTGCTATCATATTT
CTGTTGAGTGAAGGCAAGAACTCGCGAATCCTGAGGTTCGACGAGCAGCTCTTCTTCATC
TATGTACTTCCTCCCATAATCTTCAATGCAGGCTTCCAGGTCAAGAAGAAGCAGTTCTTT
CACAATTTTCTCACCATAATGTCCTTTGGGATATTCGGCGTGTTCATCTCAGTTGCGATA
GTTTCAACAGGTTGCTACTGGCTCTTCCCAAAAGTTGGTTTTGGGGACCTTGGCGCGGTA
GATTATCTAGCTTTGGGAGCAATATTTTCCTCAACAGATACTGTCTGCACATTGCAGGTC
ATCAGCCAGGATGAGACACCTAGATTGTACAGTTTGGTGTTTGGGGAAGGAGTGGTCAAT
GATGCAACCTCAGTTGTGCTTTTCAACGCTATAAAGAATCTGGATATCACTCAGCTCAAA
GGCGGGGTTGCGCTAAAAGTCATTTCAGATTTTCTCTACCTGTTCTTCACTAGCACTATG
CTTGGAGTTACAATTGGGCTATCAACTGCTTATGCTCTCAAAGCTCTGTATTTTGGTAGG
CACTCCACTGATAGGGAAGTAGCTTTGATGGCTCTCATGGCTTATTTGTCATATATGCTG
GCAGAGTTTCTTGATCTGAGTGGGATTTTGATGGTGTTCTTTTGTGGAATTGTTATGTCC
CATTACGCATGGCATAATGTGACGGAAAGCTCAAGAATCACAACCAGGCACATATTTGCA
ACGCTGTCATTTATCGCCGAGACATTCATCTTTCTTTATGTTGGAATGGATGCACTTGAC
ATTGATAAGTGGAAAACATCAGAGACAAGCTTTAAAACATCACTCGGTATCTTTGGAATC
ATCATATCGCTCGTTTTATTGGGAAGAGCTGCATTCGTTTTCCCTCTATCCATTATGTCA
AATTACATGAGTGGGAGTTCTGAAAAAGCGCCAATCACATTCAATCACCAGGTAGTGATT
TGGTGGGCGGGCCTCATGAGAGGAGCTGTTTCGATCGCACTAGCATATAATCAGTTCACC
TTTTCAGGTGTAACTTTGGATCCAGTTCATGCAACCATCATCACCAGTACAATCATTGTA
GTATTTTTCACCACTCTGGTGTTTGGCTTCTTGACAAGGCCACTCATAAGTGCCATACTC
CCGCATCAACACCGGCAATCAACGACACCGGGGACCGGAGGAGGAGGCCGTAGCACGGGC
AGCAACTCCCCGAAGGACGACTTCATCATGCCGTTCCTCTCGCCTGATGAAGAGGCGTCA
GGGAGCGGCAGTGGGTTCCTCCAGGCCAAGAGGAGCATCTCCATGCTCCTGGAGAGGCCA
GTCCACACGGTGCACATCTACTGGAGGAAGTTCGACGACAGGTTCATGAGGCCCATCTTC
GGTGGACCGATGGAGCGCGATCGCGGTAACTGTTACTGATCGAGCAGAAATAGTTGGCAC
ATTGCCACTGGAG

CDS

1626 bp

>Os06t0318500-00 Similar to Sodium/hydrogen exchanger.
ATGGCGTGGTGGTGGTGGTGGTCGGAGGCGGTGGTGGTGGGCGGAGGGACGGGCGGCGGG
AGCAGCGGCACGGTGGTGTCCATCTGCGTGTTCACGGCGGTGCTGTGCGTGTGCCTCGTC
GCCGGCCACCTCCTCGAGGAGAACAAGTGGGTCAACGAGTCCATCACCGCCCTCCTCATC
GGTTGTGTTGTAGGTGCTATCATATTTCTGTTGAGTGAAGGCAAGAACTCGCGAATCCTG
AGGTTCGACGAGCAGCTCTTCTTCATCTATGTACTTCCTCCCATAATCTTCAATGCAGGC
TTCCAGGTCAAGAAGAAGCAGTTCTTTCACAATTTTCTCACCATAATGTCCTTTGGGATA
TTCGGCGTGTTCATCTCAGTTGCGATAGTTTCAACAGGTTGCTACTGGCTCTTCCCAAAA
GTTGGTTTTGGGGACCTTGGCGCGGTAGATTATCTAGCTTTGGGAGCAATATTTTCCTCA
ACAGATACTGTCTGCACATTGCAGGTCATCAGCCAGGATGAGACACCTAGATTGTACAGT
TTGGTGTTTGGGGAAGGAGTGGTCAATGATGCAACCTCAGTTGTGCTTTTCAACGCTATA
AAGAATCTGGATATCACTCAGCTCAAAGGCGGGGTTGCGCTAAAAGTCATTTCAGATTTT
CTCTACCTGTTCTTCACTAGCACTATGCTTGGAGTTACAATTGGGCTATCAACTGCTTAT
GCTCTCAAAGCTCTGTATTTTGGTAGGCACTCCACTGATAGGGAAGTAGCTTTGATGGCT
CTCATGGCTTATTTGTCATATATGCTGGCAGAGTTTCTTGATCTGAGTGGGATTTTGATG
GTGTTCTTTTGTGGAATTGTTATGTCCCATTACGCATGGCATAATGTGACGGAAAGCTCA
AGAATCACAACCAGGCACATATTTGCAACGCTGTCATTTATCGCCGAGACATTCATCTTT
CTTTATGTTGGAATGGATGCACTTGACATTGATAAGTGGAAAACATCAGAGACAAGCTTT
AAAACATCACTCGGTATCTTTGGAATCATCATATCGCTCGTTTTATTGGGAAGAGCTGCA
TTCGTTTTCCCTCTATCCATTATGTCAAATTACATGAGTGGGAGTTCTGAAAAAGCGCCA
ATCACATTCAATCACCAGGTAGTGATTTGGTGGGCGGGCCTCATGAGAGGAGCTGTTTCG
ATCGCACTAGCATATAATCAGTTCACCTTTTCAGGTGTAACTTTGGATCCAGTTCATGCA
ACCATCATCACCAGTACAATCATTGTAGTATTTTTCACCACTCTGGTGTTTGGCTTCTTG
ACAAGGCCACTCATAAGTGCCATACTCCCGCATCAACACCGGCAATCAACGACACCGGGG
ACCGGAGGAGGAGGCCGTAGCACGGGCAGCAACTCCCCGAAGGACGACTTCATCATGCCG
TTCCTCTCGCCTGATGAAGAGGCGTCAGGGAGCGGCAGTGGGTTCCTCCAGGCCAAGAGG
AGCATCTCCATGCTCCTGGAGAGGCCAGTCCACACGGTGCACATCTACTGGAGGAAGTTC
GACGACAGGTTCATGAGGCCCATCTTCGGTGGACCGATGGAGCGCGATCGCGGTAACTGT
TACTGA

Protein

542 aa

>Os06t0318500-00 Similar to Sodium/hydrogen exchanger.
MAWWWWWSEAVVVGGGTGGGSSGTVVSICVFTAVLCVCLVAGHLLEENKWVNESITALLI
GCVVGAIIFLLSEGKNSRILRFDEQLFFIYVLPPIIFNAGFQVKKKQFFHNFLTIMSFGI
FGVFISVAIVSTGCYWLFPKVGFGDLGAVDYLALGAIFSSTDTVCTLQVISQDETPRLYS
LVFGEGVVNDATSVVLFNAIKNLDITQLKGGVALKVISDFLYLFFTSTMLGVTIGLSTAY
ALKALYFGRHSTDREVALMALMAYLSYMLAEFLDLSGILMVFFCGIVMSHYAWHNVTESS
RITTRHIFATLSFIAETFIFLYVGMDALDIDKWKTSETSFKTSLGIFGIIISLVLLGRAA
FVFPLSIMSNYMSGSSEKAPITFNHQVVIWWAGLMRGAVSIALAYNQFTFSGVTLDPVHA
TIITSTIIVVFFTTLVFGFLTRPLISAILPHQHRQSTTPGTGGGGRSTGSNSPKDDFIMP
FLSPDEEASGSGSGFLQAKRSISMLLERPVHTVHIYWRKFDDRFMRPIFGGPMERDRGNC
Y*

5'UTR

chr06:12333229..12333261 (+ strand) : 33 bp

CDS

chr06:12333262..12333441 (+ strand) : 180 bp

chr06:12334447..12334565 (+ strand) : 119 bp

chr06:12334718..12334815 (+ strand) : 98 bp

chr06:12335014..12335073 (+ strand) : 60 bp

chr06:12335147..12335193 (+ strand) : 47 bp

chr06:12335285..12335479 (+ strand) : 195 bp

chr06:12335598..12335644 (+ strand) : 47 bp

chr06:12335735..12335801 (+ strand) : 67 bp

chr06:12335892..12335992 (+ strand) : 101 bp

chr06:12336217..12336318 (+ strand) : 102 bp

chr06:12336385..12336526 (+ strand) : 142 bp

chr06:12336635..12336697 (+ strand) : 63 bp

chr06:12336781..12336864 (+ strand) : 84 bp

chr06:12336963..12337283 (+ strand) : 321 bp

3'UTR

chr06:12337284..12337317 (+ strand) : 34 bp

FASTA

>Os06t0318500-00 class=Sequence position=chr06:12333229..12337317 (+ strand)
CGCAGCAGAG AGAACAGAGA GGGGAATGCG AGGATGGCGT GGTGGTGGTG GTGGTCGGAG GCGGTGGTGG TGGGCGGAGG
GACGGGCGGC GGGAGCAGCG GCACGGTGGT GTCCATCTGC GTGTTCACGG CGGTGCTGTG CGTGTGCCTC GTCGCCGGCC
ACCTCCTCGA GGAGAACAAG TGGGTCAACG AGTCCATCAC CGCCCTCCTC ATCGTACGTC CTAGTACCTC ATCACCCCTC
CTGATAATTA CCCCCAACCA CACGTACACA ACACATGCAT ATATATATAT ATGCATATTG CATAACCTGT CTACGACTCC
CTCATCAAGC AATTAATTAA GCCGTTCGAG CTCTCTCTTT TGATCATTCA TAACCTCAAC TCAACCGCGC CGTACGCGCG
CGTTGCTAGC TGTTTGTTCC ACAGATACTC TCTATCCTAA AAGAAACCAA CATAGGTGAG GATGATATGA CCATATCCAG
ATTCATTGTa taaagctagc tacatcgtat tttcatctag gttggtcttt tgccaacttc gcgtggcgat tcacagatac
gattcaataa ttgtggtttc tttatcttgt agtgttggta ttcattagtg tgtgtttgct taatgtatgg ttagagtgtg
gttgtgaact cgctcttctg agaacatttt tgggcgtttt tgggtgattt tttgtaataa ttggctatac ctctttcaat
aaaagccgga atgatattac attatctaaa aaaaaTTAGG ATGGATTGAG CGGTCCGTTG TCGCATGTTC AGACTTCGGA
ACGACTTTTC TTTTTCTGGG GATTCTACTT GATTTTCCAG CTAGCTAAAT GTGCTTCACT GAAACTGCAG TTTTGTTTAA
CTAATGTTTA ATTAATACGA TATATTTCTA AGAACTTGGT AGCACATCAG AGGTGACAAA AAAAGTGGAG TGCTCTTCCT
TAATTAAGAA AACAAACAGT ATTTACTCCA AGGACTGCTG GTGAGAACAT TTATTCAGTG CCTTCCTTTT TATTATGCTT
GCAAAGGTAT CAACAGCTAC TACTACTGGT ACTATTTATA ATTTGCGCAG GACCAGTTCC AATTATTTTA GTACTATTTC
ATTCAATTCC TAGTAGCTTA TTAGCTCCTG TTACATTCCA ATGATGGTAC GATTAAGGAC TCCAGTTATT AAAAAGTGTG
TGTGGAATAC TCTTGCAGGG TTGTGTTGTA GGTGCTATCA TATTTCTGTT GAGTGAAGGC AAGAACTCGC GAATCCTGAG
GTTCGACGAG CAGCTCTTCT TCATCTATGT ACTTCCTCCC ATAATCTTCA ATGCAGGGTA TGTGTGCGAG TATGACATAG
TACTAGAAAT CAAATTCTTG CTTTTGGGTT TACAGGTAGT CAACACTCAA CAAGAGATAG TTCTTTCAGA TTTCTCCCAT
TGAGTGTTCA TGCATGCATG ACATATTGAC ATTACTTTTG CCTTTTCAGC TTCCAGGTCA AGAAGAAGCA GTTCTTTCAC
AATTTTCTCA CCATAATGTC CTTTGGGATA TTCGGCGTGT TCATCTCAGT TGCGATAGTT TCAACAGGTA GTTTGTTAAT
TTATAAACCT TTATGCATGT ACACACTGCT AAAAATAACC ATTTTTTTAT CTTTAAGATA TGTCAACTGT AATTTTGAGT
CTAACTGCCT AAATAATTTT ATTTCACCAT TTGTCAATTT TATTTGTAAA TGATGGAATA CTTTCAATTA AAAAGAAATA
ATGATGGGAT ACTTCTTGAT ACCAGGTTGC TACTGGCTCT TCCCAAAAGT TGGTTTTGGG GACCTTGGCG CGGTAGATTA
TCTAGGTGTG TCTTTATGTT TTGCAATTTG TTTACGTTCT CCTTTTTACT TCAGATCTAA TCTTATTTAC AACTACAGCT
TTGGGAGCAA TATTTTCCTC AACAGATACT GTCTGCACAT TGCAGGTTCG TTATACAGTT GTGTTACAAA TTTTGAATAC
ATTTTGTTTA TTCTAACTTA GCTGTTGCAA ATAAAATCAT CCGATCTCAA ATTCAGGTCA TCAGCCAGGA TGAGACACCT
AGATTGTACA GTTTGGTGTT TGGGGAAGGA GTGGTCAATG ATGCAACCTC AGTTGTGCTT TTCAACGCTA TAAAGAATCT
GGATATCACT CAGCTCAAAG GCGGGGTTGC GCTAAAAGTC ATTTCAGATT TTCTCTACCT GTTCTTCACT AGCACTATGC
TTGGAGTTAC AGTAAGCAAA CATCTTTCAG ATATCAGGTT TTTCAGTATA ACAATGCTGT TACTCTGTTT TTCTCAGAAT
TAAGGTGACC AATAACTTTT ATTACTTCTG TTTTACTACT AATTATCAGA TTGGGCTATC AACTGCTTAT GCTCTCAAAG
CTCTGTATTT TGGTAGGTAA GTATAGCAAG CCATTGGATC ATGATCCAAC TTTGAAGTCA TCTTGTTGCA CTGTTTAAAT
TTGAATATCT CCTCTTATTT CTGTAGGCAC TCCACTGATA GGGAAGTAGC TTTGATGGCT CTCATGGCTT ATTTGTCATA
TATGCTGGCA GAGGTAAGGG TGCCTTGAGA TAATTGTTGG CATTTTAACA TTTGCTCTGA TAATGTGCCT GAAGGGTAAG
GTGTGTACTA TCTTTTTGAG CAGTTTCTTG ATCTGAGTGG GATTTTGATG GTGTTCTTTT GTGGAATTGT TATGTCCCAT
TACGCATGGC ATAATGTGAC GGAAAGCTCA AGAATCACAA CCAGGTATTA TGAAGTCAGT ACCACATTTG TGAAAGACTA
GTATTAATTT TTAGAGAAAT TTATAGCTGT GTTAAGCATT ATAtttgagc aattttacgg tcgttgagaa ggtactatga
ggtaccaaaa atttagtgta aaatttgtTA CCTCATAGTA CCTAGGTTGT AAATTAAGAT TATGAAGTAA ATTAAATGAC
TCATTTGGTG TAATGGATGC AATCATAGGC ACATATTTGC AACGCTGTCA TTTATCGCCG AGACATTCAT CTTTCTTTAT
GTTGGAATGG ATGCACTTGA CATTGATAAG TGGAAAACAT CAGAGACAAG GTAATCACCG AAATGCACAT TTGTTACAAA
ATGGAAGGAG TAAACATCAT ATTATCATTT TGGCAGCTTT AAAACATCAC TCGGTATCTT TGGAATCATC ATATCGCTCG
TTTTATTGGG AAGAGCTGCA TTCGTTTTCC CTCTATCCAT TATGTCAAAT TACATGAGTG GGAGTTCTGA AAAAGCGCCA
ATCACATTCA ATCACCAGGT TTCTTCTCAG CCGTTGGTTT CAATTTCATA CAGTAACTCT TGAATTGACT TGTAGGGAAT
TCACAACGAA TTAAAATATG TACTCTAAAT TCCTCAAACA TTCAAGGTAG TGATTTGGTG GGCGGGCCTC ATGAGAGGAG
CTGTTTCGAT CGCACTAGCA TATAATCAGG TACGATTCAT ATTCAGTGTC AGGATATACA TATCTGACAA GAAGTTGATA
TACATTGATT TGTCAAACTT GCATGCTTTC AGTTCACCTT TTCAGGTGTA ACTTTGGATC CAGTTCATGC AACCATCATC
ACCAGTACAA TCATTGTAGT ATTTTTCACC ACTCTGGTAT AAACCTTTAA CACTGACGGC TCTGCATATG ATGTAATCTA
ATCCATAAAA TGTTCAGACA TGAGGCATCT GAGACATCTC CATAATTTCA TCAGGTGTTT GGCTTCTTGA CAAGGCCACT
CATAAGTGCC ATACTCCCGC ATCAACACCG GCAATCAACG ACACCGGGGA CCGGAGGAGG AGGCCGTAGC ACGGGCAGCA
ACTCCCCGAA GGACGACTTC ATCATGCCGT TCCTCTCGCC TGATGAAGAG GCGTCAGGGA GCGGCAGTGG GTTCCTCCAG
GCCAAGAGGA GCATCTCCAT GCTCCTGGAG AGGCCAGTCC ACACGGTGCA CATCTACTGG AGGAAGTTCG ACGACAGGTT
CATGAGGCCC ATCTTCGGTG GACCGATGGA GCGCGATCGC GGTAACTGTT ACTGATCGAG CAGAAATAGT TGGCACATTG
CCACTGGAG

Locus: Os06g0318500

Loading...

Locus: Os06g0318500

Loading...