Os06t0325200-01

Locus

Os06g0325200

Description

Phosphate transporter, Phosphate uptake

RAP-DB Gene Symbol Synonym(s)

PT10, OsPT10, PHT1-10, OsPht1;10

RAP-DB Gene Name Synonym(s)

PHOSPHATE TRANSPORTER 10, Probable inorganic phosphate transporter 1-10

CGSNL Gene Symbol

PT10

CGSNL Gene Name

PHOSPHATE TRANSPORTER 10

Oryzabase Gene Symbol Synonym(s)

OsPT10, PHT1-10, OsPht1;10

Oryzabase Gene Name Synonym(s)

Probable inorganic phosphate transporter 1-10

Transcript Evidence

Inferred from literature

Protein Evidence

Q69T94

Literature

PMID: 24344809

Note

Manual Curation

January 25, 2017

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: transporter activity (GO:0005215)

Molecular Function: transmembrane transporter activity (GO:0022857)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Major facilitator, sugar transporter-like (IPR005828)

Major facilitator superfamily domain (IPR020846)

Sugar transporter, conserved site (IPR005829)

Expression Databases

TENOR (Os06t0325200-00)

Others

Oryzabase (8225)

KEGG (Os06t0325200-00)

Transcript

1989 bp

>Os06t0325200-01 Phosphate transporter, Phosphate uptake
ATGGCTCCGATCGGCGTGCTCACGGCGCTGGACCAGGCGCGGACGCAGTACTACCACTTC
AAGGCCATCGTCATCGCCGGCATGGGACTCTTCACCGACTCCTACGACCTCTTCTGCATC
GCGCCCGTCATGAAGATCGTGGGCCGGGTGTACTACTCCGACGGCGGCGCCCGTCCGGGG
GTGACGCCGCCGGCCGTCGTGTCGGCGACCGTCGGAGTGGCGCTGCTGGGCGCGGTGATC
GGGAACGTGGTGTTCGGCGCGCTGGGCGACCGCGTGGGGCGGCGCCGCGTCTACGGCGCG
TGCCTGCTGCTGATGGTGTGCAGCTCCGTCGGGAGCGGCTTCTCCGTGTGCCGGACGCGC
CGGTGCGCGCTCGCCAGCCTCTGCTTCTTCCGCTTCCTCCTCGGCGTCGGCGTCGGCGGC
GACTACCCGCTGTCGGCCACCATCATGTCGGAGTTCGCCAACCGGCGCACCCGCGGCGCG
TTCATCGCCGCCGTGTTCTCCATGCAGGGGTTCGGCATCCTCGCCAGCTCCGCGGTCACC
ATGGCCGTCGCCGCCGCCTTCGACCACTACACCGGCTACCCCGCGCCGCTCGACACGCCG
GAGTGCGCCGACCTCGCCTGGCGGATCATTCTCATGGCCGGCGCCGTCCCCGCCGCGCTG
ACGTACTACTGGAGGATGTCCATGCCGGAGACGGCCAGATATACGGCTTTGGTGGAGCGC
GACGTGGTGAAGGCCACCAACGACATCGGCCGCGTTCTGGCCGACCTCGACCTGGGCGCC
GTCGCCGAGGAGGAGGTGGCGGCGGCGTTGAGCCGGCCTCCGCCGCCGCCGCGCCCTTCG
TACGGCCTCCTCTCTCGGCGCTTCGTCCGGCAGCACGGGCGGGACCTGTTCGCGTGCGCG
GCGGCGTGGTTCCTCCTCGACATCCCCTACTACAGCAGCACGCTGTTCCAGTCTCAGATC
TACCGGCCGCTGTTCCCGGCGCCGGGGCTCATCAACGCGTTCCAGGAGGCGTTCAACGTG
GCCAAGTTCCAGGCCGTCATCGCCGTCGCCTCCACCATCCCGGGCTACTTCGTCGCCGTG
CTCCTCATCGACCGCGTCGGCCGGCGGTGCCTCCAGATGGCCGGGTTCCTCCTCATGGCC
GTCTTCCTCTTCGCGCTCGCGGGTCCGTACGACGGATACTGGCGCGACCACGGCGCGCAC
GCCGGCTACATCGTGCTCTACTCGCTCACCTTCTTCTCCGCCAACCTCGGGCCGAACACC
ACCACCTTCATCCTGCCGGCGGAGCTCTTCCCGGCGCGCTTCCGGTCGACGTGCCACGGC
CTCTCCGGCGCGGCGGGGAAGCTCGGCGCGCTCGTCGGCTCCATCGGCTTCCTGTGGGCG
TCGCAGCAGAAGGACGGCGCGGCGGCCGGGCACCTGCCGGGCATCGGCATGATGTACGCG
CTGTTCGTTCTTGGCGGGATCTGCCTGCTCGGGCTGGCACTCACCTACGTGTTCACGCCG
GAGACGATGATGCGGTCGCTGGAGGAGAACGAGAGCGACAGGGCGCAGACCCAGGTCGGC
GACGGCGGCAGCGACACCGAGGCGGCCAAGAGCCCGGCGTCCATGGCGAGCTCGCACCTC
AGCATGTCGCCCATCCTTCCAGCCCGGGTCTCCGTGTGAGTGAACTCGATCATCGTCGGA
AAGCGAGAGTGCTTTTCCTCACTATTTGTGCGTCAGAGAGAGTGCATGCTGTCGAGATGT
CGATGCATGCATAAGCATGACTTGTGTACAATCTCATGGACTCACACTATATGCAAATAC
ATGTAGGATATGCATATTCAGTTTTGCTAGCAATGCATGTTTCTGATGTTGGCCATAAAC
CCTTAATCTACACTCACGCGAGTAGTGGACAATGCCTGAACAACGGACGAACACCTTGCA
AGCACTGAAAATACCTTGACGATGAACACGAGTTTTGGCAACGCGTAACTTGCCGGCTTT
TCTGTTTCA

CDS

1659 bp

>Os06t0325200-01 Phosphate transporter, Phosphate uptake
ATGGCTCCGATCGGCGTGCTCACGGCGCTGGACCAGGCGCGGACGCAGTACTACCACTTC
AAGGCCATCGTCATCGCCGGCATGGGACTCTTCACCGACTCCTACGACCTCTTCTGCATC
GCGCCCGTCATGAAGATCGTGGGCCGGGTGTACTACTCCGACGGCGGCGCCCGTCCGGGG
GTGACGCCGCCGGCCGTCGTGTCGGCGACCGTCGGAGTGGCGCTGCTGGGCGCGGTGATC
GGGAACGTGGTGTTCGGCGCGCTGGGCGACCGCGTGGGGCGGCGCCGCGTCTACGGCGCG
TGCCTGCTGCTGATGGTGTGCAGCTCCGTCGGGAGCGGCTTCTCCGTGTGCCGGACGCGC
CGGTGCGCGCTCGCCAGCCTCTGCTTCTTCCGCTTCCTCCTCGGCGTCGGCGTCGGCGGC
GACTACCCGCTGTCGGCCACCATCATGTCGGAGTTCGCCAACCGGCGCACCCGCGGCGCG
TTCATCGCCGCCGTGTTCTCCATGCAGGGGTTCGGCATCCTCGCCAGCTCCGCGGTCACC
ATGGCCGTCGCCGCCGCCTTCGACCACTACACCGGCTACCCCGCGCCGCTCGACACGCCG
GAGTGCGCCGACCTCGCCTGGCGGATCATTCTCATGGCCGGCGCCGTCCCCGCCGCGCTG
ACGTACTACTGGAGGATGTCCATGCCGGAGACGGCCAGATATACGGCTTTGGTGGAGCGC
GACGTGGTGAAGGCCACCAACGACATCGGCCGCGTTCTGGCCGACCTCGACCTGGGCGCC
GTCGCCGAGGAGGAGGTGGCGGCGGCGTTGAGCCGGCCTCCGCCGCCGCCGCGCCCTTCG
TACGGCCTCCTCTCTCGGCGCTTCGTCCGGCAGCACGGGCGGGACCTGTTCGCGTGCGCG
GCGGCGTGGTTCCTCCTCGACATCCCCTACTACAGCAGCACGCTGTTCCAGTCTCAGATC
TACCGGCCGCTGTTCCCGGCGCCGGGGCTCATCAACGCGTTCCAGGAGGCGTTCAACGTG
GCCAAGTTCCAGGCCGTCATCGCCGTCGCCTCCACCATCCCGGGCTACTTCGTCGCCGTG
CTCCTCATCGACCGCGTCGGCCGGCGGTGCCTCCAGATGGCCGGGTTCCTCCTCATGGCC
GTCTTCCTCTTCGCGCTCGCGGGTCCGTACGACGGATACTGGCGCGACCACGGCGCGCAC
GCCGGCTACATCGTGCTCTACTCGCTCACCTTCTTCTCCGCCAACCTCGGGCCGAACACC
ACCACCTTCATCCTGCCGGCGGAGCTCTTCCCGGCGCGCTTCCGGTCGACGTGCCACGGC
CTCTCCGGCGCGGCGGGGAAGCTCGGCGCGCTCGTCGGCTCCATCGGCTTCCTGTGGGCG
TCGCAGCAGAAGGACGGCGCGGCGGCCGGGCACCTGCCGGGCATCGGCATGATGTACGCG
CTGTTCGTTCTTGGCGGGATCTGCCTGCTCGGGCTGGCACTCACCTACGTGTTCACGCCG
GAGACGATGATGCGGTCGCTGGAGGAGAACGAGAGCGACAGGGCGCAGACCCAGGTCGGC
GACGGCGGCAGCGACACCGAGGCGGCCAAGAGCCCGGCGTCCATGGCGAGCTCGCACCTC
AGCATGTCGCCCATCCTTCCAGCCCGGGTCTCCGTGTGA

Protein

553 aa

>Os06t0325200-01 Phosphate transporter, Phosphate uptake
MAPIGVLTALDQARTQYYHFKAIVIAGMGLFTDSYDLFCIAPVMKIVGRVYYSDGGARPG
VTPPAVVSATVGVALLGAVIGNVVFGALGDRVGRRRVYGACLLLMVCSSVGSGFSVCRTR
RCALASLCFFRFLLGVGVGGDYPLSATIMSEFANRRTRGAFIAAVFSMQGFGILASSAVT
MAVAAAFDHYTGYPAPLDTPECADLAWRIILMAGAVPAALTYYWRMSMPETARYTALVER
DVVKATNDIGRVLADLDLGAVAEEEVAAALSRPPPPPRPSYGLLSRRFVRQHGRDLFACA
AAWFLLDIPYYSSTLFQSQIYRPLFPAPGLINAFQEAFNVAKFQAVIAVASTIPGYFVAV
LLIDRVGRRCLQMAGFLLMAVFLFALAGPYDGYWRDHGAHAGYIVLYSLTFFSANLGPNT
TTFILPAELFPARFRSTCHGLSGAAGKLGALVGSIGFLWASQQKDGAAAGHLPGIGMMYA
LFVLGGICLLGLALTYVFTPETMMRSLEENESDRAQTQVGDGGSDTEAAKSPASMASSHL
SMSPILPARVSV*

CDS

chr06:12694152..12694849 (- strand) : 698 bp

chr06:12692305..12693265 (- strand) : 961 bp

3'UTR

chr06:12691975..12692304 (- strand) : 330 bp

FASTA

>Os06t0325200-01 class=Sequence position=chr06:12691975..12694849 (- strand)
ATGGCTCCGA TCGGCGTGCT CACGGCGCTG GACCAGGCGC GGACGCAGTA CTACCACTTC AAGGCCATCG TCATCGCCGG
CATGGGACTC TTCACCGACT CCTACGACCT CTTCTGCATC GCGCCCGTCA TGAAGATCGT GGGCCGGGTG TACTACTCCG
ACGGCGGCGC CCGTCCGGGG GTGACGCCGC CGGCCGTCGT GTCGGCGACC GTCGGAGTGG CGCTGCTGGG CGCGGTGATC
GGGAACGTGG TGTTCGGCGC GCTGGGCGAC CGCGTGGGGC GGCGCCGCGT CTACGGCGCG TGCCTGCTGC TGATGGTGTG
CAGCTCCGTC GGGAGCGGCT TCTCCGTGTG CCGGACGCGC CGGTGCGCGC TCGCCAGCCT CTGCTTCTTC CGCTTCCTCC
TCGGCGTCGG CGTCGGCGGC GACTACCCGC TGTCGGCCAC CATCATGTCG GAGTTCGCCA ACCGGCGCAC CCGCGGCGCG
TTCATCGCCG CCGTGTTCTC CATGCAGGGG TTCGGCATCC TCGCCAGCTC CGCGGTCACC ATGGCCGTCG CCGCCGCCTT
CGACCACTAC ACCGGCTACC CCGCGCCGCT CGACACGCCG GAGTGCGCCG ACCTCGCCTG GCGGATCATT CTCATGGCCG
GCGCCGTCCC CGCCGCGCTG ACGTACTACT GGAGGATGTC CATGCCGGAG ACGGCCAGGT ACCAACTATA CTTGGGCCGC
TGACATGTGG TCCCAGATGT CATTCATGCA TTGGCTTCCT CCGTACCTTT GACTTCACAG CAACCATTTG AACCTTAAAA
AAATCTTAAA TAATAGTATT TGATTGGTAA ATTAGATTAA GTGTACATGG ACCGTGTTAA ACAAATGTGA TAGATAAGGA
ATATACCAAA CGAGATTCCA AGAACAAATT CTGAGAGGAA AATTTATCCT TGATAAGTAT GCTAATTGCC TGGCACTGGC
AGCTCCATGG TCAATTAAGC TTCCTTCTCT TCGTTGATGC CGAAAATTTC AAATGGATAG TTTAGTCGGA ATATTAAATA
ATTGGGCATG TTTATCGTCA CTGCCATCGT TAATTAGCAC TAGTACTTAT ACATTATATA TCCCAAAAGA AAATGTCTAC
ACATACGAAT AGCGTATACG ATTTGTGTTC GACTAGTGCA AAGCTGCTAC ATGCCTAGAC CCACATGGAA AGATATTGAG
AGTGTTGATC GGTGGTCCTA GACCCACATG GAAAGATGTT GAGAGTGTTG ATTGGTGGTC GGATGTGAGT CGTACAGCTC
CAGTCAGACG TATAGCAGAA CTCATCACGA AATTGTCTCT AGCTACTCTT TGATTTGCTA GGTGTACTGT CATTGCTGAT
GTCAGGTCTA TAAATATGAT TTTGATTTTT GATTAGTGGC ACAGTGTAAT TGCACATTTA ACCCCTTTGC ACTCTAATCA
ATAAAATTGC CCTTTAACTT TATGCTGAAA GTTGCTATAA GTGAGTAGAT TAATTACAAA AAAGGGAATT AAGCACGTAC
TAATGGTTAA TGACGAAAAA GTAATGACCG TGCATAACGT TGTATTTGTG CTGCCAACGA GCAGATATAC GGCTTTGGTG
GAGCGCGACG TGGTGAAGGC CACCAACGAC ATCGGCCGCG TTCTGGCCGA CCTCGACCTG GGCGCCGTCG CCGAGGAGGA
GGTGGCGGCG GCGTTGAGCC GGCCTCCGCC GCCGCCGCGC CCTTCGTACG GCCTCCTCTC TCGGCGCTTC GTCCGGCAGC
ACGGGCGGGA CCTGTTCGCG TGCGCGGCGG CGTGGTTCCT CCTCGACATC CCCTACTACA GCAGCACGCT GTTCCAGTCT
CAGATCTACC GGCCGCTGTT CCCGGCGCCG GGGCTCATCA ACGCGTTCCA GGAGGCGTTC AACGTGGCCA AGTTCCAGGC
CGTCATCGCC GTCGCCTCCA CCATCCCGGG CTACTTCGTC GCCGTGCTCC TCATCGACCG CGTCGGCCGG CGGTGCCTCC
AGATGGCCGG GTTCCTCCTC ATGGCCGTCT TCCTCTTCGC GCTCGCGGGT CCGTACGACG GATACTGGCG CGACCACGGC
GCGCACGCCG GCTACATCGT GCTCTACTCG CTCACCTTCT TCTCCGCCAA CCTCGGGCCG AACACCACCA CCTTCATCCT
GCCGGCGGAG CTCTTCCCGG CGCGCTTCCG GTCGACGTGC CACGGCCTCT CCGGCGCGGC GGGGAAGCTC GGCGCGCTCG
TCGGCTCCAT CGGCTTCCTG TGGGCGTCGC AGCAGAAGGA CGGCGCGGCG GCCGGGCACC TGCCGGGCAT CGGCATGATG
TACGCGCTGT TCGTTCTTGG CGGGATCTGC CTGCTCGGGC TGGCACTCAC CTACGTGTTC ACGCCGGAGA CGATGATGCG
GTCGCTGGAG GAGAACGAGA GCGACAGGGC GCAGACCCAG GTCGGCGACG GCGGCAGCGA CACCGAGGCG GCCAAGAGCC
CGGCGTCCAT GGCGAGCTCG CACCTCAGCA TGTCGCCCAT CCTTCCAGCC CGGGTCTCCG TGTGAGTGAA CTCGATCATC
GTCGGAAAGC GAGAGTGCTT TTCCTCACTA TTTGTGCGTC AGAGAGAGTG CATGCTGTCG AGATGTCGAT GCATGCATAA
GCATGACTTG TGTACAATCT CATGGACTCA CACTATATGC AAATACATGT AGGATATGCA TATTCAGTTT TGCTAGCAAT
GCATGTTTCT GATGTTGGCC ATAAACCCTT AATCTACACT CACGCGAGTA GTGGACAATG CCTGAACAAC GGACGAACAC
CTTGCAAGCA CTGAAAATAC CTTGACGATG AACACGAGTT TTGGCAACGC GTAACTTGCC GGCTTTTCTG TTTCA

Locus: Os06g0325200

Loading...

Locus: Os06g0325200

Loading...