Os06t0330100-01

Locus

Os06g0330100

Description

Blast resistance protein, Pseudogene due to premature stop mutation (most japonica varieties), Blast resistance

RAP-DB Gene Symbol Synonym(s)

Pid3

RAP-DB Gene Name Synonym(s)

Pyricularia oryzae resistance D3

CGSNL Gene Symbol

PID3

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE D3

Oryzabase Gene Symbol Synonym(s)

Pi-d3, Pid3, Pi25, Pid3-I1, qBRM6.2

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance D3, Magnaporthe grisea resistance-D3, Blast resistance D3, Pyricularia oryzae resistance-d3

Transcript Evidence

FJ773286

Protein Evidence

C0LMX9

Literature

PMID: 28871108

PMID: 19506306

Note

Manual Curation

April 3, 2018

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Leucine-rich repeat domain superfamily (IPR032675)

Virus X resistance protein-like, coiled-coil domain (IPR038005)

NB-ARC (IPR002182)

Expression Databases

TENOR (Os06t0330100-00)

Others

Oryzabase (13055)

Transcript

3224 bp

>Os06t0330100-01 Blast resistance protein, Pseudogene due to premature stop mutation (most japonica varieties), Blast resistance
GAAGCTAGCAAGCTATGGCGGAGGGTGTTGTGGGCTCACTAATCGTCAAGCTTGGGGATG
CCCTGGCGAGTGAAGCAGTGGAGGTCGCCAAGTCCTTGCTTGGGCTAGAGGGATCTGCTC
TGAAGCGCCTCTTTTCTGAGATCCGGGAGGTGAAGGGGGAGCTGGAGAGCATCCATGCCT
TCTTGCAGGCAGCCGAGCGGTTCAAGGACGCCGACGAGACAACCTCCGCGTTCGTCAAGC
AGGTGAGGAGCCTCGCCCTGAGCATCGAGGACGTAGTCGATGAGTTCACCTACGAGCTGG
GGGAAGGAGACGGCCGGATGGGGATGGCAGTGGCACTCAAGAGGATGTGCAAGATGGGCA
CATGGTCTCGCCTGGCTGGCAATCTGCAGGACATCAAGGTCAACCTGAAAAACGCTGCCG
AGAGGAGGATTAGGTATGATCTGAAGGGCGTCGAGAGAGGCGCGAAATCGATGGCGGGAA
GGAGGAGCTCAAACTGGAGATCTGACTCTGTACTCTTCAAGAGGGAGGATGAGCTTGTTG
GTATCGAGAAGAAGAGGGATTTGCTGATGAAATGGGTGAAAGATGAGGAGCAGCGCCGCA
TGGTGGTCAGTGTGTGGGGAATGAGTGGAATCGGCAAGACGGCACTGGTTGCTAATGTTT
ACAATGCTATCAAGGCTGACTTTGACACCTGTGCTTGGATCACTGTGTCTCAGAGCTACG
AGGCTGACGATTTGCTTAGGCGAACTGCTCAAGAGTTTCGCAAGAATGATCGGAAGAAAG
ACTTCCCAATTGACGTTGATATCACAAATTACAGAGGCTTGGTCGAAACCACCCGCTCTT
ACCTGGAGAACAAAAGGTATGTCCTTGTCCTAGATGATGTATGGAATGCAAATGTTTGGT
TCGATAGCAAAGATGCATTTGAAGATGGCAATATTGGCCGAATAATTCTTACATCAAGGA
ATTATGATGTGGCGTTACTTGCGCATGAAACCCATATAATTAATTTGCAGCCGTTGGAGA
AACACCATGCGTGGGATCTGTTCTGTAAAGAGGCATTTTGGAAGAATGAGATAAGGAATT
GTCCGCCGGAGTTGCAGCCCTGGGCTAATAATTTTGTTGACAAGTGCAATGGCTTGCCAA
TCGCAATTGTGTGCATTGGACGCCTTCTGTCATTTCAAGGGTCAACTTATTCAGACTGGG
AAAAGGTGTACAAAAATCTTGAGATGCAACTAACAAACAACTCTATCATGGACATGATGA
ACATTATCTTGAAGATTAGTTTGGAAGATCTACCGCACAACATTAAGAACTGCTTCCTTT
ATTGCTCCATGTTTCCTGAAAATTATGTGATGAAGAGGAAGTCCCTAGTACGACTCTGGG
TTGCTGAAGGATTTATTGAAGAAACTGAGCATAGAACACTTGAGGAAGTGGCAGAGCATT
ACTTGACTGAACTTGTGAACCGATGTCTTCTGTTGCTGGTGAAGAGAAATGAGGCTGGAC
ATGTTCATGAAGTCCAAATGCACGATATCCTCCGTGTTTTGGCTCTTTCCAAGGCTCATG
AACAAAATTTTTGCATTGTCGTTAACCACTCGAGGAGTACACATCTTATTGGAGAAGCAC
GCCGTTTATCAATTCAGAGAGGGGATTTTGCACAACTTGCAGACCATGCACCACATCTTC
GATCCTTGCTGCTTTTCCAAAGTTCACCCAATGTCAGTTCGCTTCAGTCATTACCAAAGT
CTATGAAGTTGTTGTCTGTTTTGGATCTAACTGATAGTTCAGTTGATAGGCTGCCAAAGG
AAGTGTTTGGCTTGTTCAACTTGCGTTTTCTGGGTCTCAGGCGTACTAAAATCTCCAAGC
TTCCAAGCTCCATTGGAAGGCTAAAAATTCTGCTGGTGTTGGACGCTTGGAAGTGTAAAA
TTGTAAAGCTTCCATTGGCGATTACAAAACTTCAAAAGCTAACACATCTTATTGTAACTT
CGAAAGCAGTCGTTGTTTCTAAGCAATTTGTTCCTTCTTTTGATGTGCCAGCACCTTTGC
GTATCTGCTCCATGACAACCCTTCAGACATTACTACTCATGGAAGCTAGTTCTCAAATGG
TTCATCACCTAGGCTCTCTTGTGGAGTTAAGAACCTTTCGTATCAGCAAGGTGCGAAGTT
GCCATTGTGAGCAGTTGTTCATGGCCATCACTAATATGATTCATCTTACCCGTCTTGGGA
TCTAGGCAGACAGTAGTCAAGAAGTGCTGCATCTTGAATCACTTAAACCTCCTCCTCTAC
TTCAGAAACTTTTCTTGCAAGGTACATTATCTCATGAATCATTACCTCATTTCGTGTCTG
TAAGCAATCTGAATAACCTCACGTTTCTACGTCTTGCTGGGTCAAGAATTGACGAAAATG
CATTCCTTAATCTTGAGGGATTACAGCAGTTGGTAAAGCTACAGCTTTATGATGCATATG
ATGGAATGAATATATACTTCCATGAGAACTCATTTCCAAAGCTCAGAATACTGAAAATAT
GGGGTGCCCCACACCTGAATGAAATTAAGATGACAAAAGGAGCTGTGGCAAGCCTAACAG
ATCTGAAGTTCCTGCTCTGTCCAAACCTGAAGCAGTTGCCTTGCGGTATTGAACATGTGA
GGACTCTTGAGGAGCTCACTCTGGATCATACAGCAGAAGAGCTTGTGGATAGAATCCGAC
AGAAAAAAGAGCGAATGATTTGTGACGTCCAGAGAGTTTATGTTGGGTTCATCAGAAATG
GTGTGTTGGCTGCAGAAAGGATTCAATAAGTTGGTTTCAGTCAGGATATTCATTCTTTAT
CCTGCATCATATAGTCAATGTTCAATTTTACTTTCAATACTATTTTCCCATTATGTCTTA
TTCATATTTTTTTCGATAATAGAATCTTAATTAAGCGTCTACATCCGGGATGAATCATGA
TCACCATCTGAAATTGACTTTCAATTTTTATTTGTTCCATACCCTCAATATTGTATATTC
AAATATATATATCTTTTTggcaaaatttgccacagtacatccaaaaattcgtgtaattat
tagctgggagataaaaaaaaacgctacactgccgatgtacaccataaaatttatgtaatt
ggctgtaggacttccaaggcaatattttttatcattttcaaaagGACATAAATGCCCTTG
GCTTCGATAGCATGTAAGAATGTAACCCCAACCAGACCCAATCA

CDS

2211 bp

>Os06t0330100-01 Blast resistance protein, Pseudogene due to premature stop mutation (most japonica varieties), Blast resistance
ATGGCGGAGGGTGTTGTGGGCTCACTAATCGTCAAGCTTGGGGATGCCCTGGCGAGTGAA
GCAGTGGAGGTCGCCAAGTCCTTGCTTGGGCTAGAGGGATCTGCTCTGAAGCGCCTCTTT
TCTGAGATCCGGGAGGTGAAGGGGGAGCTGGAGAGCATCCATGCCTTCTTGCAGGCAGCC
GAGCGGTTCAAGGACGCCGACGAGACAACCTCCGCGTTCGTCAAGCAGGTGAGGAGCCTC
GCCCTGAGCATCGAGGACGTAGTCGATGAGTTCACCTACGAGCTGGGGGAAGGAGACGGC
CGGATGGGGATGGCAGTGGCACTCAAGAGGATGTGCAAGATGGGCACATGGTCTCGCCTG
GCTGGCAATCTGCAGGACATCAAGGTCAACCTGAAAAACGCTGCCGAGAGGAGGATTAGG
TATGATCTGAAGGGCGTCGAGAGAGGCGCGAAATCGATGGCGGGAAGGAGGAGCTCAAAC
TGGAGATCTGACTCTGTACTCTTCAAGAGGGAGGATGAGCTTGTTGGTATCGAGAAGAAG
AGGGATTTGCTGATGAAATGGGTGAAAGATGAGGAGCAGCGCCGCATGGTGGTCAGTGTG
TGGGGAATGAGTGGAATCGGCAAGACGGCACTGGTTGCTAATGTTTACAATGCTATCAAG
GCTGACTTTGACACCTGTGCTTGGATCACTGTGTCTCAGAGCTACGAGGCTGACGATTTG
CTTAGGCGAACTGCTCAAGAGTTTCGCAAGAATGATCGGAAGAAAGACTTCCCAATTGAC
GTTGATATCACAAATTACAGAGGCTTGGTCGAAACCACCCGCTCTTACCTGGAGAACAAA
AGGTATGTCCTTGTCCTAGATGATGTATGGAATGCAAATGTTTGGTTCGATAGCAAAGAT
GCATTTGAAGATGGCAATATTGGCCGAATAATTCTTACATCAAGGAATTATGATGTGGCG
TTACTTGCGCATGAAACCCATATAATTAATTTGCAGCCGTTGGAGAAACACCATGCGTGG
GATCTGTTCTGTAAAGAGGCATTTTGGAAGAATGAGATAAGGAATTGTCCGCCGGAGTTG
CAGCCCTGGGCTAATAATTTTGTTGACAAGTGCAATGGCTTGCCAATCGCAATTGTGTGC
ATTGGACGCCTTCTGTCATTTCAAGGGTCAACTTATTCAGACTGGGAAAAGGTGTACAAA
AATCTTGAGATGCAACTAACAAACAACTCTATCATGGACATGATGAACATTATCTTGAAG
ATTAGTTTGGAAGATCTACCGCACAACATTAAGAACTGCTTCCTTTATTGCTCCATGTTT
CCTGAAAATTATGTGATGAAGAGGAAGTCCCTAGTACGACTCTGGGTTGCTGAAGGATTT
ATTGAAGAAACTGAGCATAGAACACTTGAGGAAGTGGCAGAGCATTACTTGACTGAACTT
GTGAACCGATGTCTTCTGTTGCTGGTGAAGAGAAATGAGGCTGGACATGTTCATGAAGTC
CAAATGCACGATATCCTCCGTGTTTTGGCTCTTTCCAAGGCTCATGAACAAAATTTTTGC
ATTGTCGTTAACCACTCGAGGAGTACACATCTTATTGGAGAAGCACGCCGTTTATCAATT
CAGAGAGGGGATTTTGCACAACTTGCAGACCATGCACCACATCTTCGATCCTTGCTGCTT
TTCCAAAGTTCACCCAATGTCAGTTCGCTTCAGTCATTACCAAAGTCTATGAAGTTGTTG
TCTGTTTTGGATCTAACTGATAGTTCAGTTGATAGGCTGCCAAAGGAAGTGTTTGGCTTG
TTCAACTTGCGTTTTCTGGGTCTCAGGCGTACTAAAATCTCCAAGCTTCCAAGCTCCATT
GGAAGGCTAAAAATTCTGCTGGTGTTGGACGCTTGGAAGTGTAAAATTGTAAAGCTTCCA
TTGGCGATTACAAAACTTCAAAAGCTAACACATCTTATTGTAACTTCGAAAGCAGTCGTT
GTTTCTAAGCAATTTGTTCCTTCTTTTGATGTGCCAGCACCTTTGCGTATCTGCTCCATG
ACAACCCTTCAGACATTACTACTCATGGAAGCTAGTTCTCAAATGGTTCATCACCTAGGC
TCTCTTGTGGAGTTAAGAACCTTTCGTATCAGCAAGGTGCGAAGTTGCCATTGTGAGCAG
TTGTTCATGGCCATCACTAATATGATTCATCTTACCCGTCTTGGGATCTAG

Protein

737 aa

>Os06t0330100-01 Blast resistance protein, Pseudogene due to premature stop mutation (most japonica varieties), Blast resistance
MAEGVVGSLIVKLGDALASEAVEVAKSLLGLEGSALKRLFSEIREVKGELESIHAFLQAA
ERFKDADETTSAFVKQVRSLALSIEDVVDEFTYELGEGDGRMGMAVALKRMCKMGTWSRL
AGNLQDIKVNLKNAAERRIRYDLKGVERGAKSMAGRRSSNWRSDSVLFKREDELVGIEKK
RDLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDL
LRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNANVWFDSKD
AFEDGNIGRIILTSRNYDVALLAHETHIINLQPLEKHHAWDLFCKEAFWKNEIRNCPPEL
QPWANNFVDKCNGLPIAIVCIGRLLSFQGSTYSDWEKVYKNLEMQLTNNSIMDMMNIILK
ISLEDLPHNIKNCFLYCSMFPENYVMKRKSLVRLWVAEGFIEETEHRTLEEVAEHYLTEL
VNRCLLLLVKRNEAGHVHEVQMHDILRVLALSKAHEQNFCIVVNHSRSTHLIGEARRLSI
QRGDFAQLADHAPHLRSLLLFQSSPNVSSLQSLPKSMKLLSVLDLTDSSVDRLPKEVFGL
FNLRFLGLRRTKISKLPSSIGRLKILLVLDAWKCKIVKLPLAITKLQKLTHLIVTSKAVV
VSKQFVPSFDVPAPLRICSMTTLQTLLLMEASSQMVHHLGSLVELRTFRISKVRSCHCEQ
LFMAITNMIHLTRLGI*

5'UTR

chr06:13058028..13058041 (- strand) : 14 bp

CDS

chr06:13055817..13058027 (- strand) : 2211 bp

3'UTR

chr06:13054818..13055816 (- strand) : 999 bp

FASTA

>Os06t0330100-01 class=Sequence position=chr06:13054818..13058041 (- strand)
GAAGCTAGCA AGCTATGGCG GAGGGTGTTG TGGGCTCACT AATCGTCAAG CTTGGGGATG CCCTGGCGAG TGAAGCAGTG
GAGGTCGCCA AGTCCTTGCT TGGGCTAGAG GGATCTGCTC TGAAGCGCCT CTTTTCTGAG ATCCGGGAGG TGAAGGGGGA
GCTGGAGAGC ATCCATGCCT TCTTGCAGGC AGCCGAGCGG TTCAAGGACG CCGACGAGAC AACCTCCGCG TTCGTCAAGC
AGGTGAGGAG CCTCGCCCTG AGCATCGAGG ACGTAGTCGA TGAGTTCACC TACGAGCTGG GGGAAGGAGA CGGCCGGATG
GGGATGGCAG TGGCACTCAA GAGGATGTGC AAGATGGGCA CATGGTCTCG CCTGGCTGGC AATCTGCAGG ACATCAAGGT
CAACCTGAAA AACGCTGCCG AGAGGAGGAT TAGGTATGAT CTGAAGGGCG TCGAGAGAGG CGCGAAATCG ATGGCGGGAA
GGAGGAGCTC AAACTGGAGA TCTGACTCTG TACTCTTCAA GAGGGAGGAT GAGCTTGTTG GTATCGAGAA GAAGAGGGAT
TTGCTGATGA AATGGGTGAA AGATGAGGAG CAGCGCCGCA TGGTGGTCAG TGTGTGGGGA ATGAGTGGAA TCGGCAAGAC
GGCACTGGTT GCTAATGTTT ACAATGCTAT CAAGGCTGAC TTTGACACCT GTGCTTGGAT CACTGTGTCT CAGAGCTACG
AGGCTGACGA TTTGCTTAGG CGAACTGCTC AAGAGTTTCG CAAGAATGAT CGGAAGAAAG ACTTCCCAAT TGACGTTGAT
ATCACAAATT ACAGAGGCTT GGTCGAAACC ACCCGCTCTT ACCTGGAGAA CAAAAGGTAT GTCCTTGTCC TAGATGATGT
ATGGAATGCA AATGTTTGGT TCGATAGCAA AGATGCATTT GAAGATGGCA ATATTGGCCG AATAATTCTT ACATCAAGGA
ATTATGATGT GGCGTTACTT GCGCATGAAA CCCATATAAT TAATTTGCAG CCGTTGGAGA AACACCATGC GTGGGATCTG
TTCTGTAAAG AGGCATTTTG GAAGAATGAG ATAAGGAATT GTCCGCCGGA GTTGCAGCCC TGGGCTAATA ATTTTGTTGA
CAAGTGCAAT GGCTTGCCAA TCGCAATTGT GTGCATTGGA CGCCTTCTGT CATTTCAAGG GTCAACTTAT TCAGACTGGG
AAAAGGTGTA CAAAAATCTT GAGATGCAAC TAACAAACAA CTCTATCATG GACATGATGA ACATTATCTT GAAGATTAGT
TTGGAAGATC TACCGCACAA CATTAAGAAC TGCTTCCTTT ATTGCTCCAT GTTTCCTGAA AATTATGTGA TGAAGAGGAA
GTCCCTAGTA CGACTCTGGG TTGCTGAAGG ATTTATTGAA GAAACTGAGC ATAGAACACT TGAGGAAGTG GCAGAGCATT
ACTTGACTGA ACTTGTGAAC CGATGTCTTC TGTTGCTGGT GAAGAGAAAT GAGGCTGGAC ATGTTCATGA AGTCCAAATG
CACGATATCC TCCGTGTTTT GGCTCTTTCC AAGGCTCATG AACAAAATTT TTGCATTGTC GTTAACCACT CGAGGAGTAC
ACATCTTATT GGAGAAGCAC GCCGTTTATC AATTCAGAGA GGGGATTTTG CACAACTTGC AGACCATGCA CCACATCTTC
GATCCTTGCT GCTTTTCCAA AGTTCACCCA ATGTCAGTTC GCTTCAGTCA TTACCAAAGT CTATGAAGTT GTTGTCTGTT
TTGGATCTAA CTGATAGTTC AGTTGATAGG CTGCCAAAGG AAGTGTTTGG CTTGTTCAAC TTGCGTTTTC TGGGTCTCAG
GCGTACTAAA ATCTCCAAGC TTCCAAGCTC CATTGGAAGG CTAAAAATTC TGCTGGTGTT GGACGCTTGG AAGTGTAAAA
TTGTAAAGCT TCCATTGGCG ATTACAAAAC TTCAAAAGCT AACACATCTT ATTGTAACTT CGAAAGCAGT CGTTGTTTCT
AAGCAATTTG TTCCTTCTTT TGATGTGCCA GCACCTTTGC GTATCTGCTC CATGACAACC CTTCAGACAT TACTACTCAT
GGAAGCTAGT TCTCAAATGG TTCATCACCT AGGCTCTCTT GTGGAGTTAA GAACCTTTCG TATCAGCAAG GTGCGAAGTT
GCCATTGTGA GCAGTTGTTC ATGGCCATCA CTAATATGAT TCATCTTACC CGTCTTGGGA TCTAGGCAGA CAGTAGTCAA
GAAGTGCTGC ATCTTGAATC ACTTAAACCT CCTCCTCTAC TTCAGAAACT TTTCTTGCAA GGTACATTAT CTCATGAATC
ATTACCTCAT TTCGTGTCTG TAAGCAATCT GAATAACCTC ACGTTTCTAC GTCTTGCTGG GTCAAGAATT GACGAAAATG
CATTCCTTAA TCTTGAGGGA TTACAGCAGT TGGTAAAGCT ACAGCTTTAT GATGCATATG ATGGAATGAA TATATACTTC
CATGAGAACT CATTTCCAAA GCTCAGAATA CTGAAAATAT GGGGTGCCCC ACACCTGAAT GAAATTAAGA TGACAAAAGG
AGCTGTGGCA AGCCTAACAG ATCTGAAGTT CCTGCTCTGT CCAAACCTGA AGCAGTTGCC TTGCGGTATT GAACATGTGA
GGACTCTTGA GGAGCTCACT CTGGATCATA CAGCAGAAGA GCTTGTGGAT AGAATCCGAC AGAAAAAAGA GCGAATGATT
TGTGACGTCC AGAGAGTTTA TGTTGGGTTC ATCAGAAATG GTGTGTTGGC TGCAGAAAGG ATTCAATAAG TTGGTTTCAG
TCAGGATATT CATTCTTTAT CCTGCATCAT ATAGTCAATG TTCAATTTTA CTTTCAATAC TATTTTCCCA TTATGTCTTA
TTCATATTTT TTTCGATAAT AGAATCTTAA TTAAGCGTCT ACATCCGGGA TGAATCATGA TCACCATCTG AAATTGACTT
TCAATTTTTA TTTGTTCCAT ACCCTCAATA TTGTATATTC AAATATATAT ATCTTTTTgg caaaatttgc cacagtacat
ccaaaaattc gtgtaattat tagctgggag ataaaaaaaa acgctacact gccgatgtac accataaaat ttatgtaatt
ggctgtagga cttccaaggc aatatttttt atcattttca aaagGACATA AATGCCCTTG GCTTCGATAG CATGTAAGAA
TGTAACCCCA ACCAGACCCA ATCA

Locus: Os06g0330100

Loading...

Locus: Os06g0330100

Loading...