Os06t0334400-01

Locus

Os06g0334400

Description

Similar to Cdk-activating kinase 1At (Cdk-activating kinase CAK1At).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CDKF;1

CGSNL Gene Name

CYCLIN-DEPENDENT KINASE F;1

Oryzabase Gene Symbol Synonym(s)

CDKF;1, Orysa;CDKF;1, CDKF1, CDKF-1/CAK1AT, CDKF-1, CAK1AT, CAK1A

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK120969 (DDBJ, Best hit)

Protein Evidence

Q5Z754 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J023040M24 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0334400-01)

Others

Oryzabase (13295)

Transcript

1699 bp

>Os06t0334400-01 Similar to Cdk-activating kinase 1At (Cdk-activating kinase CAK1At).
GCAGCCACATCGTCAAAATCGATCATCACCAAAAAAAAAGAAAAATCCCTAAATTACCCT
CCCCCCAAATCCCCATGGCGATCGGCGGCGGCGGCGGCGGCGGTAGCTGGAGCATCCACG
GCCGCCCCGACGTCACCTCCCGCTACGAGGTCCTCGGCCGCGCCGGCTCGGGAGCCTACG
CCGACGTCTACCGCGGCCGCCGCCGCTCCGACGGCGCCCCCGTCGCCCTCAAGGAGGTCC
ACGACGCCGTCAGCGCCCGCCGCGAGGCCGACGCCCTCCTCGCCGCCGCGCCCTCCCGCC
ACGTCGTCGCCCTCCTCGACCACTTCCCCGGCGGGGACCACGACGACGACGTCCTCGTCC
TCGAGTGGCTCCCGCTCGACCTCTCCGCCGTCGTCCGCGCCGCCGCCGCCGCCAGGCCGA
GCGCCCTCCCCGCCGCGCAGCGCAAGCGCTGGATGCTGCAGGTGCTCGAGGGCGTCGCCG
CGTGCCACAGCGCCGGGGTCGTGCACCGCGACCTCAAGCCCGCCAACCTGCTCATCTCCG
AGGACGGGGTCCTCAAGGTCGCCGACCTTGGTCAGGCCAGGATACTTCAGGAGACAGGAA
CATACCAAGGTATGCATCCATATGAGCAAAGTTCAGGAGTGGAGCCTTGGGTTTCACAAC
AACGAGCAGTGCTACATGGAGTGAAAGAGAACCACCCATCTCATGACTCAGAAACTCAAA
CTGGTCAGGAGCCAGAGAGACTCACCGCAGCTGATTACCTACATGAGATGGACCAACTCC
GGGCCAAATCCACACATGGAGATGTTGACAAAATGAGCCTACAGGATGGGAATGCCTCCT
GTCTTGCCACATGCAGCACAGCAGACATTGACGATGATCCATTTAGAGCCTCCTATTCAT
ATGACGCAGAAGAAGGCATGTTGGAAGAAGAGTCCGGTGCTTTCACTTCTTGTGTTGGCA
CACGCTGGTTTAGAGCTCCAGAGCTCCTTTATGGGTCAACAAACTATGGGCAGGAGGTTG
ACCTCTGGTCACTAGGATGTATTTTGGCTGAACTGTTTAATTTAGAGCCTATATTCCCAG
GCACATCTGATATCGATCAGATTGGTAGAATTATCAGTGTTCTGGGCAACATCACAGAAG
AAACCTTTCCAGGCTGTTCAAATCTGCCAGATTACAATAAGATTTTCTTCAACAAAGTCG
AGAAGCCAATAGGCCTCGAAGCATGCCTGCCTGATAGATCTGCTTCTGAAGTTAGTATCA
TAAAGAGGCTACTTTGCTATGACCCAACAAAGAGGGCCAGTGCTGCCGACTTGCTGAATG
ATCCATACTTCGCCGAAGAACCATTACCTGTACCTATTGAAGGATTACAAGTCCCAGAAT
CAAAGGATGAAGATGATGACAGCACAGAAGAATGGGCTAATTTCAGGGGTGGAGATTCAG
ATTCAGACTTCGATGAATTCGGCAGCATGGATGTCACCAAGACCGACAAGGGTTTCAGCA
TACGCTTCTCGTGATCAAGAATGATTGATGAGGGTAATTGTATCTTCCTGAACATGCTGG
CAGAGGAATTTCTGTCGCAGCATATTGTATGGCATTTTGATAATTGTTTTACTATTTGTA
AACTGCGATATGTTCATTATGTTGTGTACAACAGCACCAGCTTTCCTGGTAATGAGATGA
ATAAACTACAGTCTGCACC

CDS

1440 bp

>Os06t0334400-01 Similar to Cdk-activating kinase 1At (Cdk-activating kinase CAK1At).
ATGGCGATCGGCGGCGGCGGCGGCGGCGGTAGCTGGAGCATCCACGGCCGCCCCGACGTC
ACCTCCCGCTACGAGGTCCTCGGCCGCGCCGGCTCGGGAGCCTACGCCGACGTCTACCGC
GGCCGCCGCCGCTCCGACGGCGCCCCCGTCGCCCTCAAGGAGGTCCACGACGCCGTCAGC
GCCCGCCGCGAGGCCGACGCCCTCCTCGCCGCCGCGCCCTCCCGCCACGTCGTCGCCCTC
CTCGACCACTTCCCCGGCGGGGACCACGACGACGACGTCCTCGTCCTCGAGTGGCTCCCG
CTCGACCTCTCCGCCGTCGTCCGCGCCGCCGCCGCCGCCAGGCCGAGCGCCCTCCCCGCC
GCGCAGCGCAAGCGCTGGATGCTGCAGGTGCTCGAGGGCGTCGCCGCGTGCCACAGCGCC
GGGGTCGTGCACCGCGACCTCAAGCCCGCCAACCTGCTCATCTCCGAGGACGGGGTCCTC
AAGGTCGCCGACCTTGGTCAGGCCAGGATACTTCAGGAGACAGGAACATACCAAGGTATG
CATCCATATGAGCAAAGTTCAGGAGTGGAGCCTTGGGTTTCACAACAACGAGCAGTGCTA
CATGGAGTGAAAGAGAACCACCCATCTCATGACTCAGAAACTCAAACTGGTCAGGAGCCA
GAGAGACTCACCGCAGCTGATTACCTACATGAGATGGACCAACTCCGGGCCAAATCCACA
CATGGAGATGTTGACAAAATGAGCCTACAGGATGGGAATGCCTCCTGTCTTGCCACATGC
AGCACAGCAGACATTGACGATGATCCATTTAGAGCCTCCTATTCATATGACGCAGAAGAA
GGCATGTTGGAAGAAGAGTCCGGTGCTTTCACTTCTTGTGTTGGCACACGCTGGTTTAGA
GCTCCAGAGCTCCTTTATGGGTCAACAAACTATGGGCAGGAGGTTGACCTCTGGTCACTA
GGATGTATTTTGGCTGAACTGTTTAATTTAGAGCCTATATTCCCAGGCACATCTGATATC
GATCAGATTGGTAGAATTATCAGTGTTCTGGGCAACATCACAGAAGAAACCTTTCCAGGC
TGTTCAAATCTGCCAGATTACAATAAGATTTTCTTCAACAAAGTCGAGAAGCCAATAGGC
CTCGAAGCATGCCTGCCTGATAGATCTGCTTCTGAAGTTAGTATCATAAAGAGGCTACTT
TGCTATGACCCAACAAAGAGGGCCAGTGCTGCCGACTTGCTGAATGATCCATACTTCGCC
GAAGAACCATTACCTGTACCTATTGAAGGATTACAAGTCCCAGAATCAAAGGATGAAGAT
GATGACAGCACAGAAGAATGGGCTAATTTCAGGGGTGGAGATTCAGATTCAGACTTCGAT
GAATTCGGCAGCATGGATGTCACCAAGACCGACAAGGGTTTCAGCATACGCTTCTCGTGA

Protein

480 aa

>Os06t0334400-01 Similar to Cdk-activating kinase 1At (Cdk-activating kinase CAK1At).
MAIGGGGGGGSWSIHGRPDVTSRYEVLGRAGSGAYADVYRGRRRSDGAPVALKEVHDAVS
ARREADALLAAAPSRHVVALLDHFPGGDHDDDVLVLEWLPLDLSAVVRAAAAARPSALPA
AQRKRWMLQVLEGVAACHSAGVVHRDLKPANLLISEDGVLKVADLGQARILQETGTYQGM
HPYEQSSGVEPWVSQQRAVLHGVKENHPSHDSETQTGQEPERLTAADYLHEMDQLRAKST
HGDVDKMSLQDGNASCLATCSTADIDDDPFRASYSYDAEEGMLEEESGAFTSCVGTRWFR
APELLYGSTNYGQEVDLWSLGCILAELFNLEPIFPGTSDIDQIGRIISVLGNITEETFPG
CSNLPDYNKIFFNKVEKPIGLEACLPDRSASEVSIIKRLLCYDPTKRASAADLLNDPYFA
EEPLPVPIEGLQVPESKDEDDDSTEEWANFRGGDSDSDFDEFGSMDVTKTDKGFSIRFS*

5'UTR

chr06:13306501..13306574 (- strand) : 74 bp

CDS

chr06:13306000..13306500 (- strand) : 501 bp

chr06:13302747..13303685 (- strand) : 939 bp

3'UTR

chr06:13302562..13302746 (- strand) : 185 bp

FASTA

>Os06t0334400-01 class=Sequence position=chr06:13302562..13306574 (- strand)
GCAGCCACAT CGTCAAAATC GATCATCACC AAAAAAAAAG AAAAATCCCT AAATTACCCT CCCCCCAAAT CCCCATGGCG
ATCGGCGGCG GCGGCGGCGG CGGTAGCTGG AGCATCCACG GCCGCCCCGA CGTCACCTCC CGCTACGAGG TCCTCGGCCG
CGCCGGCTCG GGAGCCTACG CCGACGTCTA CCGCGGCCGC CGCCGCTCCG ACGGCGCCCC CGTCGCCCTC AAGGAGGTCC
ACGACGCCGT CAGCGCCCGC CGCGAGGCCG ACGCCCTCCT CGCCGCCGCG CCCTCCCGCC ACGTCGTCGC CCTCCTCGAC
CACTTCCCCG GCGGGGACCA CGACGACGAC GTCCTCGTCC TCGAGTGGCT CCCGCTCGAC CTCTCCGCCG TCGTCCGCGC
CGCCGCCGCC GCCAGGCCGA GCGCCCTCCC CGCCGCGCAG CGCAAGCGCT GGATGCTGCA GGTGCTCGAG GGCGTCGCCG
CGTGCCACAG CGCCGGGGTC GTGCACCGCG ACCTCAAGCC CGCCAACCTG CTCATCTCCG AGGACGGGGT CCTCAAGGTC
GCCGACCTTG GTCAGGTTAA ATTTCTCCAA ACTTCAGCTC AATTCCGCAA GTAGTGTATA CTCTTATATG GGTTTGGGCA
TAGTGAATTT ATTATGGAAT TGGTACCTCG ATGTGTAAAT TATGTTTATT TTGATAGTGG TATATGATGT CACTGCATCA
CTAGTTATCT Taggccgtgt ttagatccca cccaaaattt tttcaccctg ccatatcgaa cgtttgaaca catgcataaa
gtattaaata taggctaaaa aaataaccaa ttgcacatat tgcgactaat ttgcaagatg aatcttttaa gcctaattgc
tccatgattt gacaatgtgg tgttacccta aacatttggt aatgatggat taattaggct taataaattc gtatcgcggt
ttattgatgg attctgtaat tagttttttt attagtgcgc gaacacccca tgcgacaata tataatacct gatgtgacac
gccaaaactt tacacccctg gatctaatca ccccctTACC TCGGTTGGTT CGAAAACATT GTGTTAAATG TTCTTTTGGA
TAGTCTATGG TTTTACTGAA TGTCTGAATG TGATGTGGCG CTTAAACATC ACAAACCATT GAAACACTAG GCTTCACAAG
GGACGGTTAT GCGGGACAGC TTCAAATGAT TAGTTGCAAT CTTAGTTCAG CAGTAAGATG TTTGCATCGT TGGAAAGTTG
AACTTTGTGT TGGATCTGTG TGGATAGACC TCTAATTTTT GTCCTTCTTG TTGTGTTCCC TTTTCTTCTA TGGAAATTAG
AGAAGACTTG CTTATGTAAT CTGGAAGCAG ATTATTCATG TGCCAAAACA GCTTCTAAAC CGTATTCGAT GTTTTTGGCA
CAGAAGATGT ACAGTTCATA TATGGAGTAG CATATACCCA TAACCCATCT TTAAGGATGT AGGGAGCCAT AATTTGTGGA
ATTTTCTTTG CTTAGATATA TATGTACAAG ATATGCTTGC TTGTATGTAG ATGAAAAGAA CTGATATTTA CAGAGCTTGG
GCTGTGCGTT TATTTAATGC ATTTACTTTT ATCACCCCCT CCTTTTTTAT ATGCACATGT TTTAATCAAT CAAATGTTCC
ACCATGTAGT TCAAGGAAAT ATAGTTGAAA GACTGTTAAC ATTTTTATTT TGGTTGTGTA ATAATCTTTT CATGGGACAA
AGAATCACTA CTTCAATATG AGTACTAGCA TACTCAAATT TTGTTGTTTA GCTTAAAAGC TGGTGACTTT GATCATTTCA
ATAATTCAAT GACAACAAAG ATTAATTGAC AATATTCTGC AGCCTACCAG TTTTGTGTTT TTTTAGAAAC TTATGGATCC
AAACCTGAAG TCATTTTCTT ATGTCACAGT TTTTTATGTC TTTAAGTTGA CATTTTGACA TGATTCAATT CACTACCTGG
TTGTTCTCTA ATGCATTGTT GGGCGATTTG TACCCTTTAC AGACCTTTTC AACCAATGAG ACTTGACAGG ACAACATAAG
TTGAGGTTGC ATTTCCCTAT GGAATGTGCC TGCCTTTCCT TTTAAGAATG CATAATAATT TGTATGCACT GCTTCAGCCA
TAAAACATTG CATAATCAGT ATCGTTCCTT TTTGCGCCAT TGCATGTCTG TTTTTTTGGT ATAAACGGTC ATTTGAGATT
GGCCACTAGA TGTGTTACTA TGAAAATGTT TGTTCTCCAC GTCTTTTATA TTGTGTTACG GTGGGAAGTT GGTGGTATGT
TACTTACTGG TTAGTGGTTA CTATCTTGAC TCATGAGAGT TCAACAATTC AGCCTATTCA TAACTAAATT TGTTTGCAGA
AAGAAACCAG AGCATAGTGA ATACTGTTCA AACATATGTA CTCAAGTAGT CAGCAACCCC AAATGAAATG CAACTGTTTA
TTGTTTATAT TTCATAAATT GGCATGATTT TGTCAATTGT TTTTACATTG CTATATTCAA GTTACTTTTA GTCTGTGTTT
TAAAAAGATG GCCATGAAGG CTTTAATTCC AAACTTTGGT GAAGATGTTT TGGGATCTAT GTTTGCTTAT ATACTCAATT
TCTAATtaca aagcaccact acagaaatga ttttttactt cattagcatc aatctcccaa gggagagttc atctaaatga
ggAACACAGG AAGCGTATAT GTGGTTATTG GTCGATGATA TAGTTGCTCC TCCTTTGTTT TCTTGTGAAA TGTGATATAA
TGTCGGAATG GCAACCTGTA TAATGGATCC AAATGCTTTA GCTGGTTGGA TTTTGAGTTT TTGACACAGT TCTTTTGTTA
TGTTCTCAGG CCAGGATACT TCAGGAGACA GGAACATACC AAGGTATGCA TCCATATGAG CAAAGTTCAG GAGTGGAGCC
TTGGGTTTCA CAACAACGAG CAGTGCTACA TGGAGTGAAA GAGAACCACC CATCTCATGA CTCAGAAACT CAAACTGGTC
AGGAGCCAGA GAGACTCACC GCAGCTGATT ACCTACATGA GATGGACCAA CTCCGGGCCA AATCCACACA TGGAGATGTT
GACAAAATGA GCCTACAGGA TGGGAATGCC TCCTGTCTTG CCACATGCAG CACAGCAGAC ATTGACGATG ATCCATTTAG
AGCCTCCTAT TCATATGACG CAGAAGAAGG CATGTTGGAA GAAGAGTCCG GTGCTTTCAC TTCTTGTGTT GGCACACGCT
GGTTTAGAGC TCCAGAGCTC CTTTATGGGT CAACAAACTA TGGGCAGGAG GTTGACCTCT GGTCACTAGG ATGTATTTTG
GCTGAACTGT TTAATTTAGA GCCTATATTC CCAGGCACAT CTGATATCGA TCAGATTGGT AGAATTATCA GTGTTCTGGG
CAACATCACA GAAGAAACCT TTCCAGGCTG TTCAAATCTG CCAGATTACA ATAAGATTTT CTTCAACAAA GTCGAGAAGC
CAATAGGCCT CGAAGCATGC CTGCCTGATA GATCTGCTTC TGAAGTTAGT ATCATAAAGA GGCTACTTTG CTATGACCCA
ACAAAGAGGG CCAGTGCTGC CGACTTGCTG AATGATCCAT ACTTCGCCGA AGAACCATTA CCTGTACCTA TTGAAGGATT
ACAAGTCCCA GAATCAAAGG ATGAAGATGA TGACAGCACA GAAGAATGGG CTAATTTCAG GGGTGGAGAT TCAGATTCAG
ACTTCGATGA ATTCGGCAGC ATGGATGTCA CCAAGACCGA CAAGGGTTTC AGCATACGCT TCTCGTGATC AAGAATGATT
GATGAGGGTA ATTGTATCTT CCTGAACATG CTGGCAGAGG AATTTCTGTC GCAGCATATT GTATGGCATT TTGATAATTG
TTTTACTATT TGTAAACTGC GATATGTTCA TTATGTTGTG TACAACAGCA CCAGCTTTCC TGGTAATGAG ATGAATAAAC
TACAGTCTGC ACC

Locus: Os06g0334400

Loading...

Locus: Os06g0334400

Loading...