Os06t0334400-02

Locus

Os06g0334400

Description

Similar to Cyclin-dependent kinase F-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CDKF;1

CGSNL Gene Name

CYCLIN-DEPENDENT KINASE F;1

Oryzabase Gene Symbol Synonym(s)

CDKF;1, Orysa;CDKF;1, CDKF1, CDKF-1/CAK1AT, CDKF-1, CAK1AT, CAK1A

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059487 (DDBJ, Best hit)

Protein Evidence

Q5Z754 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

001-028-G02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0334400-02)

Others

Oryzabase (13295)

Transcript

1348 bp

>Os06t0334400-02 Similar to Cyclin-dependent kinase F-1.
TCCTCGTCCTCGAGTGGCTCCCGCTCGACCTCTCCGCCGTCGTCCGCGCCGCCGCCGCCG
CCAGGCCGAGCGCCCTCCCCGCCGCGCAGCGCAAGCGCTGGATGCTGCAGGTGCTCGAGG
GCGTCGCCGCGTGCCACAGCGCCGGGGTCGTGCACCGCGACCTCAAGCCCGCCAACCTGC
TCATCTCCGAGGACGGGGTCCTCAAGGTCGCCGACCTTGGTCAGGCCAGGATACTTCAGG
AGACAGGAACATACCAAGGTATGCATCCATATGAGCAAAGTTCAGGAGTGGAGCCTTGGG
TTTCACAACAACGAGCAGTGCTACATGGAGTGAAAGAGAACCACCCATCTCATGACTCAG
AAACTCAAACTGGTCAGGAGCCAGAGAGACTCACCGCAGCTGATTACCTACATGAGATGG
ACCAACTCCGGGCCAAATCCACACATGGAGATGTTGACAAAATGAGCCTACAGGATGGGA
ATGCCTCCTGTCTTGCCACATGCAGCACAGCAGACATTGACGATGATCCATTTAGAGCCT
CCTATTCATATGACGCAGAAGAAGGCATGTTGGAAGAAGAGTCCGGTGCTTTCACTTCTT
GTGTTGGCACACGCTGGTTTAGAGCTCCAGAGCTCCTTTATGGGTCAACAAACTATGGGC
AGGAGGTTGACCTCTGGTCACTAGGATGTATTTTGGCTGAACTGTTTAATTTAGAGCCTA
TATTCCCAGGCACATCTGATATCGATCAGATTGGTAGAATTATCAGTGTTCTGGGCAACA
TCACAGAAGAAACCTTTCCAGGCTGTTCAAATCTGCCAGATTACAATAAGATTTTCTTCA
ACAAAGTCGAGAAGCCAATAGGCCTCGAAGCATGCCTGCCTGATAGATCTGCTTCTGAAG
TTAGTATCATAAAGAGGCTACTTTGCTATGACCCAACAAAGAGGGCCAGTGCTGCCGACT
TGCTGAATGATCCATACTTCGCCGAAGAACCATTACCTGTACCTATTGAAGGATTACAAG
TCCCAGAATCAAAGGATGAAGATGATGACAGCACAGAAGAATGGGCTAATTTCAGGGGTG
GAGATTCAGATTCAGACTTCGATGAATTCGGCAGCATGGATGTCACCAAGACCGACAAGG
GTTTCAGCATACGCTTCTCGTGATCAAGAATGATTGATGAGGGTAATTGTATCTTCCTGA
ACATGCTGGCAGAGGAATTTCTGTCGCAGCATATTGTATGGCATTTTGATAATTGTTTTA
CTATTTGTAAACTGCGATATGTTCATTATGTTGTGTACAACAGCACCAGCTTTCCTGGTA
ATGAGATGAATAAACTACAGTCTGCACC

CDS

1161 bp

>Os06t0334400-02 Similar to Cyclin-dependent kinase F-1.
CTCGTCCTCGAGTGGCTCCCGCTCGACCTCTCCGCCGTCGTCCGCGCCGCCGCCGCCGCC
AGGCCGAGCGCCCTCCCCGCCGCGCAGCGCAAGCGCTGGATGCTGCAGGTGCTCGAGGGC
GTCGCCGCGTGCCACAGCGCCGGGGTCGTGCACCGCGACCTCAAGCCCGCCAACCTGCTC
ATCTCCGAGGACGGGGTCCTCAAGGTCGCCGACCTTGGTCAGGCCAGGATACTTCAGGAG
ACAGGAACATACCAAGGTATGCATCCATATGAGCAAAGTTCAGGAGTGGAGCCTTGGGTT
TCACAACAACGAGCAGTGCTACATGGAGTGAAAGAGAACCACCCATCTCATGACTCAGAA
ACTCAAACTGGTCAGGAGCCAGAGAGACTCACCGCAGCTGATTACCTACATGAGATGGAC
CAACTCCGGGCCAAATCCACACATGGAGATGTTGACAAAATGAGCCTACAGGATGGGAAT
GCCTCCTGTCTTGCCACATGCAGCACAGCAGACATTGACGATGATCCATTTAGAGCCTCC
TATTCATATGACGCAGAAGAAGGCATGTTGGAAGAAGAGTCCGGTGCTTTCACTTCTTGT
GTTGGCACACGCTGGTTTAGAGCTCCAGAGCTCCTTTATGGGTCAACAAACTATGGGCAG
GAGGTTGACCTCTGGTCACTAGGATGTATTTTGGCTGAACTGTTTAATTTAGAGCCTATA
TTCCCAGGCACATCTGATATCGATCAGATTGGTAGAATTATCAGTGTTCTGGGCAACATC
ACAGAAGAAACCTTTCCAGGCTGTTCAAATCTGCCAGATTACAATAAGATTTTCTTCAAC
AAAGTCGAGAAGCCAATAGGCCTCGAAGCATGCCTGCCTGATAGATCTGCTTCTGAAGTT
AGTATCATAAAGAGGCTACTTTGCTATGACCCAACAAAGAGGGCCAGTGCTGCCGACTTG
CTGAATGATCCATACTTCGCCGAAGAACCATTACCTGTACCTATTGAAGGATTACAAGTC
CCAGAATCAAAGGATGAAGATGATGACAGCACAGAAGAATGGGCTAATTTCAGGGGTGGA
GATTCAGATTCAGACTTCGATGAATTCGGCAGCATGGATGTCACCAAGACCGACAAGGGT
TTCAGCATACGCTTCTCGTGA

Protein

387 aa

>Os06t0334400-02 Similar to Cyclin-dependent kinase F-1.
LVLEWLPLDLSAVVRAAAAARPSALPAAQRKRWMLQVLEGVAACHSAGVVHRDLKPANLL
ISEDGVLKVADLGQARILQETGTYQGMHPYEQSSGVEPWVSQQRAVLHGVKENHPSHDSE
TQTGQEPERLTAADYLHEMDQLRAKSTHGDVDKMSLQDGNASCLATCSTADIDDDPFRAS
YSYDAEEGMLEEESGAFTSCVGTRWFRAPELLYGSTNYGQEVDLWSLGCILAELFNLEPI
FPGTSDIDQIGRIISVLGNITEETFPGCSNLPDYNKIFFNKVEKPIGLEACLPDRSASEV
SIIKRLLCYDPTKRASAADLLNDPYFAEEPLPVPIEGLQVPESKDEDDDSTEEWANFRGG
DSDSDFDEFGSMDVTKTDKGFSIRFS*

5'UTR

chr06:13306222..13306223 (- strand) : 2 bp

CDS

chr06:13306000..13306221 (- strand) : 222 bp

chr06:13302747..13303685 (- strand) : 939 bp

3'UTR

chr06:13302562..13302746 (- strand) : 185 bp

FASTA

>Os06t0334400-02 class=Sequence position=chr06:13302562..13306223 (- strand)
TCCTCGTCCT CGAGTGGCTC CCGCTCGACC TCTCCGCCGT CGTCCGCGCC GCCGCCGCCG CCAGGCCGAG CGCCCTCCCC
GCCGCGCAGC GCAAGCGCTG GATGCTGCAG GTGCTCGAGG GCGTCGCCGC GTGCCACAGC GCCGGGGTCG TGCACCGCGA
CCTCAAGCCC GCCAACCTGC TCATCTCCGA GGACGGGGTC CTCAAGGTCG CCGACCTTGG TCAGGTTAAA TTTCTCCAAA
CTTCAGCTCA ATTCCGCAAG TAGTGTATAC TCTTATATGG GTTTGGGCAT AGTGAATTTA TTATGGAATT GGTACCTCGA
TGTGTAAATT ATGTTTATTT TGATAGTGGT ATATGATGTC ACTGCATCAC TAGTTATCTT aggccgtgtt tagatcccac
ccaaaatttt ttcaccctgc catatcgaac gtttgaacac atgcataaag tattaaatat aggctaaaaa aataaccaat
tgcacatatt gcgactaatt tgcaagatga atcttttaag cctaattgct ccatgatttg acaatgtggt gttaccctaa
acatttggta atgatggatt aattaggctt aataaattcg tatcgcggtt tattgatgga ttctgtaatt agttttttta
ttagtgcgcg aacaccccat gcgacaatat ataatacctg atgtgacacg ccaaaacttt acacccctgg atctaatcac
cccctTACCT CGGTTGGTTC GAAAACATTG TGTTAAATGT TCTTTTGGAT AGTCTATGGT TTTACTGAAT GTCTGAATGT
GATGTGGCGC TTAAACATCA CAAACCATTG AAACACTAGG CTTCACAAGG GACGGTTATG CGGGACAGCT TCAAATGATT
AGTTGCAATC TTAGTTCAGC AGTAAGATGT TTGCATCGTT GGAAAGTTGA ACTTTGTGTT GGATCTGTGT GGATAGACCT
CTAATTTTTG TCCTTCTTGT TGTGTTCCCT TTTCTTCTAT GGAAATTAGA GAAGACTTGC TTATGTAATC TGGAAGCAGA
TTATTCATGT GCCAAAACAG CTTCTAAACC GTATTCGATG TTTTTGGCAC AGAAGATGTA CAGTTCATAT ATGGAGTAGC
ATATACCCAT AACCCATCTT TAAGGATGTA GGGAGCCATA ATTTGTGGAA TTTTCTTTGC TTAGATATAT ATGTACAAGA
TATGCTTGCT TGTATGTAGA TGAAAAGAAC TGATATTTAC AGAGCTTGGG CTGTGCGTTT ATTTAATGCA TTTACTTTTA
TCACCCCCTC CTTTTTTATA TGCACATGTT TTAATCAATC AAATGTTCCA CCATGTAGTT CAAGGAAATA TAGTTGAAAG
ACTGTTAACA TTTTTATTTT GGTTGTGTAA TAATCTTTTC ATGGGACAAA GAATCACTAC TTCAATATGA GTACTAGCAT
ACTCAAATTT TGTTGTTTAG CTTAAAAGCT GGTGACTTTG ATCATTTCAA TAATTCAATG ACAACAAAGA TTAATTGACA
ATATTCTGCA GCCTACCAGT TTTGTGTTTT TTTAGAAACT TATGGATCCA AACCTGAAGT CATTTTCTTA TGTCACAGTT
TTTTATGTCT TTAAGTTGAC ATTTTGACAT GATTCAATTC ACTACCTGGT TGTTCTCTAA TGCATTGTTG GGCGATTTGT
ACCCTTTACA GACCTTTTCA ACCAATGAGA CTTGACAGGA CAACATAAGT TGAGGTTGCA TTTCCCTATG GAATGTGCCT
GCCTTTCCTT TTAAGAATGC ATAATAATTT GTATGCACTG CTTCAGCCAT AAAACATTGC ATAATCAGTA TCGTTCCTTT
TTGCGCCATT GCATGTCTGT TTTTTTGGTA TAAACGGTCA TTTGAGATTG GCCACTAGAT GTGTTACTAT GAAAATGTTT
GTTCTCCACG TCTTTTATAT TGTGTTACGG TGGGAAGTTG GTGGTATGTT ACTTACTGGT TAGTGGTTAC TATCTTGACT
CATGAGAGTT CAACAATTCA GCCTATTCAT AACTAAATTT GTTTGCAGAA AGAAACCAGA GCATAGTGAA TACTGTTCAA
ACATATGTAC TCAAGTAGTC AGCAACCCCA AATGAAATGC AACTGTTTAT TGTTTATATT TCATAAATTG GCATGATTTT
GTCAATTGTT TTTACATTGC TATATTCAAG TTACTTTTAG TCTGTGTTTT AAAAAGATGG CCATGAAGGC TTTAATTCCA
AACTTTGGTG AAGATGTTTT GGGATCTATG TTTGCTTATA TACTCAATTT CTAATtacaa agcaccacta cagaaatgat
tttttacttc attagcatca atctcccaag ggagagttca tctaaatgag gAACACAGGA AGCGTATATG TGGTTATTGG
TCGATGATAT AGTTGCTCCT CCTTTGTTTT CTTGTGAAAT GTGATATAAT GTCGGAATGG CAACCTGTAT AATGGATCCA
AATGCTTTAG CTGGTTGGAT TTTGAGTTTT TGACACAGTT CTTTTGTTAT GTTCTCAGGC CAGGATACTT CAGGAGACAG
GAACATACCA AGGTATGCAT CCATATGAGC AAAGTTCAGG AGTGGAGCCT TGGGTTTCAC AACAACGAGC AGTGCTACAT
GGAGTGAAAG AGAACCACCC ATCTCATGAC TCAGAAACTC AAACTGGTCA GGAGCCAGAG AGACTCACCG CAGCTGATTA
CCTACATGAG ATGGACCAAC TCCGGGCCAA ATCCACACAT GGAGATGTTG ACAAAATGAG CCTACAGGAT GGGAATGCCT
CCTGTCTTGC CACATGCAGC ACAGCAGACA TTGACGATGA TCCATTTAGA GCCTCCTATT CATATGACGC AGAAGAAGGC
ATGTTGGAAG AAGAGTCCGG TGCTTTCACT TCTTGTGTTG GCACACGCTG GTTTAGAGCT CCAGAGCTCC TTTATGGGTC
AACAAACTAT GGGCAGGAGG TTGACCTCTG GTCACTAGGA TGTATTTTGG CTGAACTGTT TAATTTAGAG CCTATATTCC
CAGGCACATC TGATATCGAT CAGATTGGTA GAATTATCAG TGTTCTGGGC AACATCACAG AAGAAACCTT TCCAGGCTGT
TCAAATCTGC CAGATTACAA TAAGATTTTC TTCAACAAAG TCGAGAAGCC AATAGGCCTC GAAGCATGCC TGCCTGATAG
ATCTGCTTCT GAAGTTAGTA TCATAAAGAG GCTACTTTGC TATGACCCAA CAAAGAGGGC CAGTGCTGCC GACTTGCTGA
ATGATCCATA CTTCGCCGAA GAACCATTAC CTGTACCTAT TGAAGGATTA CAAGTCCCAG AATCAAAGGA TGAAGATGAT
GACAGCACAG AAGAATGGGC TAATTTCAGG GGTGGAGATT CAGATTCAGA CTTCGATGAA TTCGGCAGCA TGGATGTCAC
CAAGACCGAC AAGGGTTTCA GCATACGCTT CTCGTGATCA AGAATGATTG ATGAGGGTAA TTGTATCTTC CTGAACATGC
TGGCAGAGGA ATTTCTGTCG CAGCATATTG TATGGCATTT TGATAATTGT TTTACTATTT GTAAACTGCG ATATGTTCAT
TATGTTGTGT ACAACAGCAC CAGCTTTCCT GGTAATGAGA TGAATAAACT ACAGTCTGCA CC

Locus: Os06g0334400

Loading...

Locus: Os06g0334400

Loading...