Os06t0335500-01

Locus

Os06g0335500

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA21

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA21

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 21

Transcript Evidence

AK121989 (DDBJ, Best hit)

Protein Evidence

Q5Z749 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033109C03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0335500-01)

RiceXPro (AK121989)

Others

Oryzabase (10909)

KEGG (Os06t0335500-01)

Transcript

1273 bp

>Os06t0335500-01 AUX/IAA protein family protein.
GTCTTCCTCCTCCCACTCTCGCACTTCTCGCATCGCAAAGCTCGGCAGCAAAAGCAAAGC
AAAGCCAAGCCAAGCTTGAAGCTCCCCGCACTGAGCCAAGAAGCCTCCACCTCAATCCGA
AAGAGATCTCGTGCGCGCACGGCGATGCGGTGAATCGGGCATGGCGCCGCCACAGGAGCG
GGACTACATCGGGCTGTCGCCGGCGGCGGCGGCGGCGCTGGCAACGGAGCTGCGCCTTGG
GCTGCCGGGGACTGCGGAGGAGGCTGAGTCGGAGGGCGGCGGAGGAGGAGGGACGGATGC
GGCTCCGCTGACGCTCGAGCTGCTGCCCAAGGGCGGGGCCAAGCGCGGGTTCGCGGACGC
CATCGTTGGGGGTCCCGCCGGCCAGCGGCGGGAGGCGGCCGGGGGCAAGGCGGCGGCGGC
GGCGGCGGAGGCCGAGGAGGAGGAGGAGAAGAAGAAGGCGCAGGCGCCGGCGGCGAAGGC
ACAGGTGGTAGGATGGCCACCAATCCGCAGCTACAGGAAGAACACCATGGCGATGAGCCA
GCCTGCTCTGAAAGGCAAAGACGACGGCGAGGCGAAGCAGGCTCCGGCATCCGGTTGCCT
CTATGTCAAGGTGAGCATGGATGGTGCTCCTTACCTCAGGAAGGTGGACCTCAAGATGTA
CAAGAACTACAAGGAGCTCTCTTTGGCTCTGGAGAAGATGTTCAGCTGCTTTACCGTCGG
TCATGGTGAATCAAATGGGAAGTCAGGGAGAGATGGATTATCTGATTGCCGCCTGATGGA
TCTTAAAAATGGAACAGAACTTGTGCTCACTTATGAGGACAAGGATGAAGATTGGATGCT
TGTTGGTGATGTTCCGTGGCGAATGTTCACAGACAGCTGTAGGAGGCTGAGGATTATGAA
GGGGTCAGATGCAGTGGGCCTTGCTCCAAGAGCCACTGACAAGAGCAAAAATCGGAACTG
AGCAAAAGATGAACCCAATATGAATATCCGACCCCTACAATCACATCACTTTTACTTGTA
AGGTCCCATTCTCTAAACCACAAGGGTAATGGTCTAAGTTGCGAGAAGGGGATTACTTAT
ACCTATGTGTCACCCTCTTTTTTTTTTGTTTTTATTTGTACCAATTATGTTAGATTTTAA
GCGTAAGTTGTGTAAGTTCCTGTAAGTTGTCTACTTAACCTTGCTTGTAGTTTCTTCTGT
AAATTGTTGTGCTGTATGATGCAAACTATTTTTGGTATTTTACTTGGTGCTTGCAAGTTG
CAATTGTCCGTGC

CDS

801 bp

>Os06t0335500-01 AUX/IAA protein family protein.
ATGGCGCCGCCACAGGAGCGGGACTACATCGGGCTGTCGCCGGCGGCGGCGGCGGCGCTG
GCAACGGAGCTGCGCCTTGGGCTGCCGGGGACTGCGGAGGAGGCTGAGTCGGAGGGCGGC
GGAGGAGGAGGGACGGATGCGGCTCCGCTGACGCTCGAGCTGCTGCCCAAGGGCGGGGCC
AAGCGCGGGTTCGCGGACGCCATCGTTGGGGGTCCCGCCGGCCAGCGGCGGGAGGCGGCC
GGGGGCAAGGCGGCGGCGGCGGCGGCGGAGGCCGAGGAGGAGGAGGAGAAGAAGAAGGCG
CAGGCGCCGGCGGCGAAGGCACAGGTGGTAGGATGGCCACCAATCCGCAGCTACAGGAAG
AACACCATGGCGATGAGCCAGCCTGCTCTGAAAGGCAAAGACGACGGCGAGGCGAAGCAG
GCTCCGGCATCCGGTTGCCTCTATGTCAAGGTGAGCATGGATGGTGCTCCTTACCTCAGG
AAGGTGGACCTCAAGATGTACAAGAACTACAAGGAGCTCTCTTTGGCTCTGGAGAAGATG
TTCAGCTGCTTTACCGTCGGTCATGGTGAATCAAATGGGAAGTCAGGGAGAGATGGATTA
TCTGATTGCCGCCTGATGGATCTTAAAAATGGAACAGAACTTGTGCTCACTTATGAGGAC
AAGGATGAAGATTGGATGCTTGTTGGTGATGTTCCGTGGCGAATGTTCACAGACAGCTGT
AGGAGGCTGAGGATTATGAAGGGGTCAGATGCAGTGGGCCTTGCTCCAAGAGCCACTGAC
AAGAGCAAAAATCGGAACTGA

Protein

267 aa

>Os06t0335500-01 AUX/IAA protein family protein.
MAPPQERDYIGLSPAAAAALATELRLGLPGTAEEAESEGGGGGGTDAAPLTLELLPKGGA
KRGFADAIVGGPAGQRREAAGGKAAAAAAEAEEEEEKKKAQAPAAKAQVVGWPPIRSYRK
NTMAMSQPALKGKDDGEAKQAPASGCLYVKVSMDGAPYLRKVDLKMYKNYKELSLALEKM
FSCFTVGHGESNGKSGRDGLSDCRLMDLKNGTELVLTYEDKDEDWMLVGDVPWRMFTDSC
RRLRIMKGSDAVGLAPRATDKSKNRN*

5'UTR

chr06:13345347..13345506 (+ strand) : 160 bp

CDS

chr06:13345507..13345823 (+ strand) : 317 bp

chr06:13346607..13346848 (+ strand) : 242 bp

chr06:13347537..13347678 (+ strand) : 142 bp

chr06:13348287..13348348 (+ strand) : 62 bp

chr06:13348706..13348743 (+ strand) : 38 bp

3'UTR

chr06:13348744..13349055 (+ strand) : 312 bp

FASTA

>Os06t0335500-01 class=Sequence position=chr06:13345347..13349055 (+ strand)
GTCTTCCTCC TCCCACTCTC GCACTTCTCG CATCGCAAAG CTCGGCAGCA AAAGCAAAGC AAAGCCAAGC CAAGCTTGAA
GCTCCCCGCA CTGAGCCAAG AAGCCTCCAC CTCAATCCGA AAGAGATCTC GTGCGCGCAC GGCGATGCGG TGAATCGGGC
ATGGCGCCGC CACAGGAGCG GGACTACATC GGGCTGTCGC CGGCGGCGGC GGCGGCGCTG GCAACGGAGC TGCGCCTTGG
GCTGCCGGGG ACTGCGGAGG AGGCTGAGTC GGAGGGCGGC GGAGGAGGAG GGACGGATGC GGCTCCGCTG ACGCTCGAGC
TGCTGCCCAA GGGCGGGGCC AAGCGCGGGT TCGCGGACGC CATCGTTGGG GGTCCCGCCG GCCAGCGGCG GGAGGCGGCC
GGGGGCAAGG CGGCGGCGGC GGCGGCGGAG GCCGAGGAGG AGGAGGAGAA GAAGAAGGCG CAGGCGCCGG CGGCGAAGTA
GGTGGACTCG GGACTCGGGT TGGTGTGCGT GGGTTCGCCG GTTGGTTGGC TGGCGGTTTA AGCTGATAAA AAAAAAAAGC
TTTTCCCCCT TCTTTGCAAA AGTTTTCTCG TTTCATCGTC TTTTGGGGTG ATTCATGGAA TTTCCTGCGT GGGTTTATAT
GAACTTGGGT GAAATGAATT TTGGAGCTCT TCCTGATGAG GTTTCAAACT GCGAAGATGT TTTGGTCACT CGATTTTGGT
CATGCACTTT GAGAAATTTA GGCGGTTTTG CCAAGAAAAC AAATACGGTT TAGTTTTTGA CGGGCTTCAT TGAATTTCTT
TTGTAGAAAT CATATGATTT CCGCCATACT TCTTGTGGTT GATTTATTCC GAATTTCCTG ATTATTTCGG AGTTTGGGCG
TTCATGTTTG CCCAAACTTG TTAGTAAAAT TTATCGTATA TATTTAACTA AAGAGGAATT CTACCGAGAA AAATAGCTGT
CTTTGTTCTG AGAAAGCTGG AGAAGCTTTC CTCCCCTCAT CTTGTGGGGG TCACTGTTTC TACTGTCAAA AGTGCGCACT
TTTGTGTACC TGTTCTCCAT TTGCATGATG CCAATTGCCA ATGGGCTTAA ATTCACTGCA ACAAGGCAGT GAGCGAAATT
CTCCACTTCA CATGGATTTT TATTCTCCCT GCTTTGGCGT ATGTATCTTG CTGCGAATTT CAGCAGTTCA TGTATAACTT
TTTAAGCAAC CTTGGAAGTG TATGGTTATC AGTGTTACAG TGTGTGTAAT TCTGCAACAG GGCACAGGTG GTAGGATGGC
CACCAATCCG CAGCTACAGG AAGAACACCA TGGCGATGAG CCAGCCTGCT CTGAAAGGCA AAGACGACGG CGAGGCGAAG
CAGGCTCCGG CATCCGGTTG CCTCTATGTC AAGGTGAGCA TGGATGGTGC TCCTTACCTC AGGAAGGTGG ACCTCAAGAT
GTACAAGAAC TACAAGGAGC TCTCTTTGGC TCTGGAGAAG ATGTTCAGCT GCTTTACCGT CGGTGAGCTC TCGTTTTTGC
GCCTAATTTT TTCATTTCCT TGTTGCTGTT GTGAGGTAGT AGTTCTTTCT TTAACTGATG CTGTTCTTAC CATATCGAGG
TAGATCTAGT TTCCTTGGAC TTGGAGACCA GACAATTCTC CATGCCATTT ATATTAATTA AATGTGGATT TGTCACATTT
GGCATTCTAC ATACTGTAGT CATGTAGTGT AACTGTTGGT TCAGTGCATA AAGAACTAGG GCCTGATGCT GTTGTTTGTT
AAATATTAAT GGTTTGCTGG ATTACTTCTC ATCCAATCAT TTACATTACT GTGATCCTTG GAACTATTGT TCTACTTCTC
TTATTATCTT CCATGGCAAG TAACGTTGCT GTGCAAGTGA AGCTTTCGGT TTTAGATTGT TCTGCCTTCC TATTCTAGAA
CTGAAATTTT AGTTTACGTG TACGGTGTTA TGTCATGCTG TTTGTGCTGA ACTGTAGCCT TCTACAAATG CCCTTGCTCT
TGCTTCTAAG TCTAAGAATA CGTAAATGAA GCAGTGATGA CAGTATTGTT GTTTGATTCA TAAATTTTAG TTACTGCATA
ATTTGGATTT TTCCCATCAA TTGATTGGTC TCTGTTAACG CCATCTATTG TTCAGCTTTA TTGGAAATGT TCCTGAACAG
GGTTTACTTT CATATTTTGG GCTCCTGCAG GTCATGGTGA ATCAAATGGG AAGTCAGGGA GAGATGGATT ATCTGATTGC
CGCCTGATGG ATCTTAAAAA TGGAACAGAA CTTGTGCTCA CTTATGAGGA CAAGGATGAA GATTGGATGC TTGTTGGTGA
TGTTCCGTGG CGGTGAGTAA TGCTTATACC GCAAAATTTG TTTCCTACAA TCGTAAGCAA TGATGATGTT TTAATCCGTA
TCAGTGTATC TGCAAATATC AAACTAGCTA GTGAAGTTTT AGTGACTTCT ATATTTCCAT CTTCGCATGA CCTTATGCCT
TGCTTGTTTG ATGGATTGAC TTGTTCTGGT AGGATGCAAA GTTTACTATA TTGTTTTCTA CTTGTATATG AAATCTAAAA
AGGCCTGATA CTATGGTTCC TGACAAGTCA CGTCCCATTT ATAGTGAATA CTTTATCTTT CATTAGAACA CCATATAGCT
GTTAGTCAAA GAAAGTAGTG AAGTTGAGAA ATATTTGGGT TATGGTAACA AATGTCTAAT TGCAATCCTT GTGTCATATT
CACCTATATT AGTGGTGGGT CCTATATTTC GTCTCCTTAC TTGAACAGCC TTTATTTTAG GTTATTTCCT GAAATTTCAT
GGTCTGCAGT TCTGCGCTGC ATTTCACTTC CTGGCCCACC AAGTTTACAC ACATTCCAAT GAGTTCTTGG CTTGAGACCA
GAACATGCTA TTCTTAAAAG GCCACTTGAC GTCTATTTTT TTTTATTTGT TGTATTGCAG AATGTTCACA GACAGCTGTA
GGAGGCTGAG GATTATGAAG GGGTCAGATG CAGTGGGCCT TGGTAAGTAC AGATCCCATG TGGTACAATA TTGAAGTATT
GCATGTGTCC ATGCCTTTTT ATCTGGAAGC ATAGAAGAGA ATTTACTGTA TGTTGCTCTG CATAAGTGCA TAATTACACC
TTATATATGC TTTACACATA AAAATCAGAA GTGCCAGTTT GCATGGACTA GGTTTGGTCC GAGCCCTTAA CTATGGGACT
AAGATATCTG GTTATCCTAT TCTTTTTATG TATCTGACAG AGAATCTCTG TGTATCAGGA AAAAATGTGT CCTCTGTTAA
CCATGGGCAA TATGGCATCT TATTCTTTGT GCTTATTTCA TACTGAGAAT GTTATAATTT ATTTACCATC ATTTTTCAGC
TCCAAGAGCC ACTGACAAGA GCAAAAATCG GAACTGAGCA AAAGATGAAC CCAATATGAA TATCCGACCC CTACAATCAC
ATCACTTTTA CTTGTAAGGT CCCATTCTCT AAACCACAAG GGTAATGGTC TAAGTTGCGA GAAGGGGATT ACTTATACCT
ATGTGTCACC CTCTTTTTTT TTTGTTTTTA TTTGTACCAA TTATGTTAGA TTTTAAGCGT AAGTTGTGTA AGTTCCTGTA
AGTTGTCTAC TTAACCTTGC TTGTAGTTTC TTCTGTAAAT TGTTGTGCTG TATGATGCAA ACTATTTTTG GTATTTTACT
TGGTGCTTGC AAGTTGCAAT TGTCCGTGC

Locus: Os06g0335500

Loading...

Locus: Os06g0335500

Loading...