Os06t0335500-02

Locus

Os06g0335500

Description

Similar to Auxin-responsive protein IAA21.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA21

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA21

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 21

Transcript Evidence

AK063854 (DDBJ, Best hit)

Protein Evidence

Q5Z749 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

001-122-D03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0335500-02)

RiceXPro (AK063854)

Others

Oryzabase (10909)

KEGG (Os06t0335500-02)

Transcript

552 bp

>Os06t0335500-02 Similar to Auxin-responsive protein IAA21.
CATGGTGAATCAAATGGGAAGTCAGGGAGAGATGGATTATCTGATTGCCGCCTGATGGAT
CTTAAAAATGGAACAGAACTTGTGCTCACTTATGAGGACAAGGATGAAGATTGGATGCTT
GTTGGTGATGTTCCGTGGCGAATGTTCACAGACAGCTGTAGGAGGCTGAGGATTATGAAG
GGGTCAGATGCAGTGGGCCTTGCTCCAAGAGCCACTGACAAGAGCAAAAATCGGAACTGA
GCAAAAGATGAACCCAATATGAATATCCGACCCCTACAATCACATCACTTTTACTTGTAA
GGTCCCATTCTCTAAACCACAAGGGTAATGGTCTAAGTTGCGAGAAGGGGATTACTTATA
CCTATGTGTCACCCTCTTTTTTTTTTGTTTTTATTTGTACCAATTATGTTAGATTTTAAG
CGTAAGTTGTGTAAGTTCCTGTAAGTTGTCTACTTAACCTTGCTTGTAGTTTCTTCTGTA
AATTGTTGTGCTGTATGATGCAAACTATTTTTGGTATTTTACTTGGTGCTTGCAAGTTGC
AATTGTCCGTGC

CDS

240 bp

>Os06t0335500-02 Similar to Auxin-responsive protein IAA21.
CATGGTGAATCAAATGGGAAGTCAGGGAGAGATGGATTATCTGATTGCCGCCTGATGGAT
CTTAAAAATGGAACAGAACTTGTGCTCACTTATGAGGACAAGGATGAAGATTGGATGCTT
GTTGGTGATGTTCCGTGGCGAATGTTCACAGACAGCTGTAGGAGGCTGAGGATTATGAAG
GGGTCAGATGCAGTGGGCCTTGCTCCAAGAGCCACTGACAAGAGCAAAAATCGGAACTGA

Protein

80 aa

>Os06t0335500-02 Similar to Auxin-responsive protein IAA21.
HGESNGKSGRDGLSDCRLMDLKNGTELVLTYEDKDEDWMLVGDVPWRMFTDSCRRLRIMK
GSDAVGLAPRATDKSKNRN*

CDS

chr06:13347539..13347678 (+ strand) : 140 bp

chr06:13348287..13348348 (+ strand) : 62 bp

chr06:13348706..13348743 (+ strand) : 38 bp

3'UTR

chr06:13348744..13349055 (+ strand) : 312 bp

FASTA

>Os06t0335500-02 class=Sequence position=chr06:13347539..13349055 (+ strand)
CATGGTGAAT CAAATGGGAA GTCAGGGAGA GATGGATTAT CTGATTGCCG CCTGATGGAT CTTAAAAATG GAACAGAACT
TGTGCTCACT TATGAGGACA AGGATGAAGA TTGGATGCTT GTTGGTGATG TTCCGTGGCG GTGAGTAATG CTTATACCGC
AAAATTTGTT TCCTACAATC GTAAGCAATG ATGATGTTTT AATCCGTATC AGTGTATCTG CAAATATCAA ACTAGCTAGT
GAAGTTTTAG TGACTTCTAT ATTTCCATCT TCGCATGACC TTATGCCTTG CTTGTTTGAT GGATTGACTT GTTCTGGTAG
GATGCAAAGT TTACTATATT GTTTTCTACT TGTATATGAA ATCTAAAAAG GCCTGATACT ATGGTTCCTG ACAAGTCACG
TCCCATTTAT AGTGAATACT TTATCTTTCA TTAGAACACC ATATAGCTGT TAGTCAAAGA AAGTAGTGAA GTTGAGAAAT
ATTTGGGTTA TGGTAACAAA TGTCTAATTG CAATCCTTGT GTCATATTCA CCTATATTAG TGGTGGGTCC TATATTTCGT
CTCCTTACTT GAACAGCCTT TATTTTAGGT TATTTCCTGA AATTTCATGG TCTGCAGTTC TGCGCTGCAT TTCACTTCCT
GGCCCACCAA GTTTACACAC ATTCCAATGA GTTCTTGGCT TGAGACCAGA ACATGCTATT CTTAAAAGGC CACTTGACGT
CTATTTTTTT TTATTTGTTG TATTGCAGAA TGTTCACAGA CAGCTGTAGG AGGCTGAGGA TTATGAAGGG GTCAGATGCA
GTGGGCCTTG GTAAGTACAG ATCCCATGTG GTACAATATT GAAGTATTGC ATGTGTCCAT GCCTTTTTAT CTGGAAGCAT
AGAAGAGAAT TTACTGTATG TTGCTCTGCA TAAGTGCATA ATTACACCTT ATATATGCTT TACACATAAA AATCAGAAGT
GCCAGTTTGC ATGGACTAGG TTTGGTCCGA GCCCTTAACT ATGGGACTAA GATATCTGGT TATCCTATTC TTTTTATGTA
TCTGACAGAG AATCTCTGTG TATCAGGAAA AAATGTGTCC TCTGTTAACC ATGGGCAATA TGGCATCTTA TTCTTTGTGC
TTATTTCATA CTGAGAATGT TATAATTTAT TTACCATCAT TTTTCAGCTC CAAGAGCCAC TGACAAGAGC AAAAATCGGA
ACTGAGCAAA AGATGAACCC AATATGAATA TCCGACCCCT ACAATCACAT CACTTTTACT TGTAAGGTCC CATTCTCTAA
ACCACAAGGG TAATGGTCTA AGTTGCGAGA AGGGGATTAC TTATACCTAT GTGTCACCCT CTTTTTTTTT TGTTTTTATT
TGTACCAATT ATGTTAGATT TTAAGCGTAA GTTGTGTAAG TTCCTGTAAG TTGTCTACTT AACCTTGCTT GTAGTTTCTT
CTGTAAATTG TTGTGCTGTA TGATGCAAAC TATTTTTGGT ATTTTACTTG GTGCTTGCAA GTTGCAATTG TCCGTGC

Locus: Os06g0335500

Loading...

Locus: Os06g0335500

Loading...