Os06t0336500-01

Locus

Os06g0336500

Description

Similar to CSLD2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLD5

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE D5

Oryzabase Gene Symbol Synonym(s)

OsCSLD5

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK072260 (DDBJ, Best hit)

Protein Evidence

Q5Z6E5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

J023005B09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0336500-01)

RiceXPro (AK072260)

Others

Oryzabase (9015)

KEGG (Os06t0336500-01)

Transcript

3632 bp

>Os06t0336500-01 Similar to CSLD2 (Fragment).
CTTCGCAGCAATGGCGAGAGCCGCATGGGGGCTCCGAGAAGCTAGCTAGCTAGGACGAAC
GCGAATGTCCTCGTCGTCGGCGGCACCCAGGCAGCCACCCGAGACAGGTTTACGCGGCGG
ACGGCGAGCCTAGCGGCCTCCCGCGGCCGCAGCCTCTCCAACCCACGACCACGACGACCA
CCTCGACGTCGCGCTGGAGTACCCGTCCTTCGCCGCCATGTCGGTCGACTACGCCAACTA
CACCGTCCTCATGCCGCCCACCCCGGACAACCAGCCGTCCGGGGGTGCCCCGCCCGCGGC
GCCGTCCGCCGGTGGCGCTAGGCCGGGCGATCTGCCGCTCCCGCCCTATGGCTCGTCGTC
CTCCTCCAGGCTCGTCAACCGGCGCGGTGGCGGCGACGACGGCGCCAAGATGGACCGGCG
GCTGTCGACGGCGCGCGTCCCGGCGCCGTCCAGCAACAAGTCGCTGCTGGTGCGCagcca
gaccggtgacttcgaccacaaccggtggctgttcgagaccaagggcacgtacggcatcgg
gaacgcctactggccccaggacaacgtgtacggcgacgacggcggcggcggcgccgtcaa
gatggaggacctcgtcgagaagccgtggaagccgctgagccgcaaggtgcccatccctcc
gggcatcctcagcccctacaggCTGCTGGTGTTGGTGCGGTTCGTGGCGCTCTTCCTCTT
CTTGGTGTGGCGCGTCACCAACCCTAACATggacgcgctctggctgtgggggatctccat
cgtgtgcgagttttggttcgccttctcctggctgctcgaccagatgcccaagctgaaccc
gatcaaccgcgccgccgacctcgccgcgctcaaggagaagttcgagtcgccgtcgccgac
gaacccgacggggcgctccgacctgccggggcttgacgtcttcatctccaccgccgaccc
ctacaaggagccgacgctggtgacggccaacacgctcctctccatcctcgccaccgagta
ccccgtggagaagctgttcgtctacatctccgacgacggcggcgcgctgctgaccttcga
gtccatggcggaggcgtgcgcgttcgccaaggtgtgggtgcccttctgccgcaagcacag
catcgagccgcgcaacccggattcctacttcacgcagaagggcgacccgaccaagggcaa
gaagcggccggacttcgtcaaggaccgccgctggatcaagcgcgagtacgacgagttcaa
gatccgcgtgaacagcctccccgacctcatccgccgccgcgccaacgccctgaacgcccg
cgagcgcaagctggcgcgcgacaagcaggccgccggcgacgccgacgcactcgcctccgt
gaaggccgccacctggatggccgacggcacgcactggccgggcacctggctggacccgtc
ccccgaccacgccaagggcgaccacgccagcatcgtgcaggtgatgatcaagaacccgca
ccacgacgtggtgtacggcgaggccggcgaccacccgtacctggacatgaccgacgtgga
catgcgcatcccgatgttcgcctacctgtcgcgggagaagcgcgccgggtacgaccacaa
caagaaggccggcgccatgaacgccatggtgcgcgcgtcggcgatcctctccaatggccc
cttcatgctcaacttcgactgcgaccactacatctacaactgccaggccatccgcgaggc
catgtgctacatgctcgaccgcggcggcgaccgcatctgctacatccagttcccgcagcg
gttcgaggggatcgacccctccgaccgctacgccaaccacaacaccgtcttcttcgacgg
caacatgcgcgcgctcgacggcctccagggccccatgtacgtcggcacgggctgcctctt
ccgccgctacgccatctacggcttcaacccgccgcgcgccatcgagtaccgcggcaccta
cggccagaccaaggtgcccatcgacccgcgacaaggcagcgaagccatgcccggcgccgg
cggcggccgcagcggcggcggcagcgtgggcggcgaccacgagctgcaggcgctgtcgac
ggcgcacccggaccacgaggcgccgcagaagttcggcaagtccaagatgttcatcgagtc
catcgcggtggccgagtaccaggggcggccgctgcaggaccacccgtccgtcctgaacgg
tcgcccccccggcgcgctgctgatgccgcggccgcctctggacgcggcgacggtggcgga
gtcggtgtcggtgatctcgtgctggtacgaggacaacacggagtgggggcagcgcgtggg
gtggatctacgggtcggtgacggaggacgtggtgaccgggtaccggatgcacaaccgcgg
gtggcggtcggtgtactgcatcacccggcgcgacgcgttccgcgggacggcgccgatcaa
cctgacggacaggctgcaccaggtgctccggtgggcgacggggtcggtggagatcttctt
ctccaagaacaacgcggtgctggcgtccaggcggctcaagttcctgcagcggatggcgta
cctcaacgttgggatctaccccttcacgtcgctcttcctcatcatgtactgcctcctccc
ggcgctgtcgctcttctcggggcagttcatcgtggcgacgctggacccgacgttcctctc
ctacctgctgctcatcaccatcaccctcatgctgctctgcctgctggaggtgaagtggtc
cgggatcgggctggaggagtggtggcggaacgagcagttctgggtgatcggcggcacgtc
ggcgcacctggcggcggtgctgcagggcctgctcaaggtggtggccgggatcgagatctc
cttcacgctcacggccaaggcggcggcggaggacgacgacgaccccttcgccgagctcta
cctcatcaagtggacgtcgctcttcatcccgccgctcgccgtcatcgggatcaacatcat
cgcgctcgtcgtcggcgtgtcgcggacggtgtacgcggagatcccgcagtacagcaagct
gctcggcggcggcttcttcagcttctgggtgctcgcgcactactacccgttcgccaaggg
cctcatgggccgccgcggccggacgcccaccatcgtctacgtctgggccggcctcatctc
catcaccgtctctctcctctggatcaccattagccccccGGATGATAGCGTCGCGCAGGG
CGGCATCGACGTGTGACTTTTCGTGACACACACCATCACCCATCACTGGTACTAAGATCG
ATCGAGATATGCATGGCCAGACATACAAGAAATTGCCAAGAGATTTATATGTGCCAATTG
CATGAACCGTGCACTACATGCATCGATCAGATTTGCACTGTACGTTCAAGATGTTCTGGT
TAGTGTGTCGTGTTGGAGTACTGATTTGGTTTTTGTAAGAAAGAATTTGCTGGGTTTATT
AGCATGTACGTCCTGTGTTACTTAAGGATGCCAGAGCAGGGTCCATTTTGTACAAGAGTT
TCCCATGTGTGTACCAATATACGGACAGGGCAGTACTGACTGACTGTACATGATTTTCTG
TATTTGGGTTCTGGTAAAATTACCTATTCTTG

CDS

3039 bp

>Os06t0336500-01 Similar to CSLD2 (Fragment).
ATGTCGGTCGACTACGCCAACTACACCGTCCTCATGCCGCCCACCCCGGACAACCAGCCG
TCCGGGGGTGCCCCGCCCGCGGCGCCGTCCGCCGGTGGCGCTAGGCCGGGCGATCTGCCG
CTCCCGCCCTATGGCTCGTCGTCCTCCTCCAGGCTCGTCAACCGGCGCGGTGGCGGCGAC
GACGGCGCCAAGATGGACCGGCGGCTGTCGACGGCGCGCGTCCCGGCGCCGTCCAGCAAC
AAGTCGCTGCTGGTGCGCagccagaccggtgacttcgaccacaaccggtggctgttcgag
accaagggcacgtacggcatcgggaacgcctactggccccaggacaacgtgtacggcgac
gacggcggcggcggcgccgtcaagatggaggacctcgtcgagaagccgtggaagccgctg
agccgcaaggtgcccatccctccgggcatcctcagcccctacaggCTGCTGGTGTTGGTG
CGGTTCGTGGCGCTCTTCCTCTTCTTGGTGTGGCGCGTCACCAACCCTAACATggacgcg
ctctggctgtgggggatctccatcgtgtgcgagttttggttcgccttctcctggctgctc
gaccagatgcccaagctgaacccgatcaaccgcgccgccgacctcgccgcgctcaaggag
aagttcgagtcgccgtcgccgacgaacccgacggggcgctccgacctgccggggcttgac
gtcttcatctccaccgccgacccctacaaggagccgacgctggtgacggccaacacgctc
ctctccatcctcgccaccgagtaccccgtggagaagctgttcgtctacatctccgacgac
ggcggcgcgctgctgaccttcgagtccatggcggaggcgtgcgcgttcgccaaggtgtgg
gtgcccttctgccgcaagcacagcatcgagccgcgcaacccggattcctacttcacgcag
aagggcgacccgaccaagggcaagaagcggccggacttcgtcaaggaccgccgctggatc
aagcgcgagtacgacgagttcaagatccgcgtgaacagcctccccgacctcatccgccgc
cgcgccaacgccctgaacgcccgcgagcgcaagctggcgcgcgacaagcaggccgccggc
gacgccgacgcactcgcctccgtgaaggccgccacctggatggccgacggcacgcactgg
ccgggcacctggctggacccgtcccccgaccacgccaagggcgaccacgccagcatcgtg
caggtgatgatcaagaacccgcaccacgacgtggtgtacggcgaggccggcgaccacccg
tacctggacatgaccgacgtggacatgcgcatcccgatgttcgcctacctgtcgcgggag
aagcgcgccgggtacgaccacaacaagaaggccggcgccatgaacgccatggtgcgcgcg
tcggcgatcctctccaatggccccttcatgctcaacttcgactgcgaccactacatctac
aactgccaggccatccgcgaggccatgtgctacatgctcgaccgcggcggcgaccgcatc
tgctacatccagttcccgcagcggttcgaggggatcgacccctccgaccgctacgccaac
cacaacaccgtcttcttcgacggcaacatgcgcgcgctcgacggcctccagggccccatg
tacgtcggcacgggctgcctcttccgccgctacgccatctacggcttcaacccgccgcgc
gccatcgagtaccgcggcacctacggccagaccaaggtgcccatcgacccgcgacaaggc
agcgaagccatgcccggcgccggcggcggccgcagcggcggcggcagcgtgggcggcgac
cacgagctgcaggcgctgtcgacggcgcacccggaccacgaggcgccgcagaagttcggc
aagtccaagatgttcatcgagtccatcgcggtggccgagtaccaggggcggccgctgcag
gaccacccgtccgtcctgaacggtcgcccccccggcgcgctgctgatgccgcggccgcct
ctggacgcggcgacggtggcggagtcggtgtcggtgatctcgtgctggtacgaggacaac
acggagtgggggcagcgcgtggggtggatctacgggtcggtgacggaggacgtggtgacc
gggtaccggatgcacaaccgcgggtggcggtcggtgtactgcatcacccggcgcgacgcg
ttccgcgggacggcgccgatcaacctgacggacaggctgcaccaggtgctccggtgggcg
acggggtcggtggagatcttcttctccaagaacaacgcggtgctggcgtccaggcggctc
aagttcctgcagcggatggcgtacctcaacgttgggatctaccccttcacgtcgctcttc
ctcatcatgtactgcctcctcccggcgctgtcgctcttctcggggcagttcatcgtggcg
acgctggacccgacgttcctctcctacctgctgctcatcaccatcaccctcatgctgctc
tgcctgctggaggtgaagtggtccgggatcgggctggaggagtggtggcggaacgagcag
ttctgggtgatcggcggcacgtcggcgcacctggcggcggtgctgcagggcctgctcaag
gtggtggccgggatcgagatctccttcacgctcacggccaaggcggcggcggaggacgac
gacgaccccttcgccgagctctacctcatcaagtggacgtcgctcttcatcccgccgctc
gccgtcatcgggatcaacatcatcgcgctcgtcgtcggcgtgtcgcggacggtgtacgcg
gagatcccgcagtacagcaagctgctcggcggcggcttcttcagcttctgggtgctcgcg
cactactacccgttcgccaagggcctcatgggccgccgcggccggacgcccaccatcgtc
tacgtctgggccggcctcatctccatcaccgtctctctcctctggatcaccattagcccc
ccGGATGATAGCGTCGCGCAGGGCGGCATCGACGTGTGA

Protein

1013 aa

>Os06t0336500-01 Similar to CSLD2 (Fragment).
MSVDYANYTVLMPPTPDNQPSGGAPPAAPSAGGARPGDLPLPPYGSSSSSRLVNRRGGGD
DGAKMDRRLSTARVPAPSSNKSLLVRSQTGDFDHNRWLFETKGTYGIGNAYWPQDNVYGD
DGGGGAVKMEDLVEKPWKPLSRKVPIPPGILSPYRLLVLVRFVALFLFLVWRVTNPNMDA
LWLWGISIVCEFWFAFSWLLDQMPKLNPINRAADLAALKEKFESPSPTNPTGRSDLPGLD
VFISTADPYKEPTLVTANTLLSILATEYPVEKLFVYISDDGGALLTFESMAEACAFAKVW
VPFCRKHSIEPRNPDSYFTQKGDPTKGKKRPDFVKDRRWIKREYDEFKIRVNSLPDLIRR
RANALNARERKLARDKQAAGDADALASVKAATWMADGTHWPGTWLDPSPDHAKGDHASIV
QVMIKNPHHDVVYGEAGDHPYLDMTDVDMRIPMFAYLSREKRAGYDHNKKAGAMNAMVRA
SAILSNGPFMLNFDCDHYIYNCQAIREAMCYMLDRGGDRICYIQFPQRFEGIDPSDRYAN
HNTVFFDGNMRALDGLQGPMYVGTGCLFRRYAIYGFNPPRAIEYRGTYGQTKVPIDPRQG
SEAMPGAGGGRSGGGSVGGDHELQALSTAHPDHEAPQKFGKSKMFIESIAVAEYQGRPLQ
DHPSVLNGRPPGALLMPRPPLDAATVAESVSVISCWYEDNTEWGQRVGWIYGSVTEDVVT
GYRMHNRGWRSVYCITRRDAFRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAVLASRRL
KFLQRMAYLNVGIYPFTSLFLIMYCLLPALSLFSGQFIVATLDPTFLSYLLLITITLMLL
CLLEVKWSGIGLEEWWRNEQFWVIGGTSAHLAAVLQGLLKVVAGIEISFTLTAKAAAEDD
DDPFAELYLIKWTSLFIPPLAVIGINIIALVVGVSRTVYAEIPQYSKLLGGGFFSFWVLA
HYYPFAKGLMGRRGRTPTIVYVWAGLISITVSLLWITISPPDDSVAQGGIDV*

5'UTR

chr06:13414641..13414857 (+ strand) : 217 bp

CDS

chr06:13414858..13417896 (+ strand) : 3039 bp

3'UTR

chr06:13417897..13418272 (+ strand) : 376 bp

FASTA

>Os06t0336500-01 class=Sequence position=chr06:13414641..13418272 (+ strand)
CTTCGCAGCA ATGGCGAGAG CCGCATGGGG GCTCCGAGAA GCTAGCTAGC TAGGACGAAC GCGAATGTCC TCGTCGTCGG
CGGCACCCAG GCAGCCACCC GAGACAGGTT TACGCGGCGG ACGGCGAGCC TAGCGGCCTC CCGCGGCCGC AGCCTCTCCA
ACCCACGACC ACGACGACCA CCTCGACGTC GCGCTGGAGT ACCCGTCCTT CGCCGCCATG TCGGTCGACT ACGCCAACTA
CACCGTCCTC ATGCCGCCCA CCCCGGACAA CCAGCCGTCC GGGGGTGCCC CGCCCGCGGC GCCGTCCGCC GGTGGCGCTA
GGCCGGGCGA TCTGCCGCTC CCGCCCTATG GCTCGTCGTC CTCCTCCAGG CTCGTCAACC GGCGCGGTGG CGGCGACGAC
GGCGCCAAGA TGGACCGGCG GCTGTCGACG GCGCGCGTCC CGGCGCCGTC CAGCAACAAG TCGCTGCTGG TGCGCagcca
gaccggtgac ttcgaccaca accggtggct gttcgagacc aagggcacgt acggcatcgg gaacgcctac tggccccagg
acaacgtgta cggcgacgac ggcggcggcg gcgccgtcaa gatggaggac ctcgtcgaga agccgtggaa gccgctgagc
cgcaaggtgc ccatccctcc gggcatcctc agcccctaca ggCTGCTGGT GTTGGTGCGG TTCGTGGCGC TCTTCCTCTT
CTTGGTGTGG CGCGTCACCA ACCCTAACAT ggacgcgctc tggctgtggg ggatctccat cgtgtgcgag ttttggttcg
ccttctcctg gctgctcgac cagatgccca agctgaaccc gatcaaccgc gccgccgacc tcgccgcgct caaggagaag
ttcgagtcgc cgtcgccgac gaacccgacg gggcgctccg acctgccggg gcttgacgtc ttcatctcca ccgccgaccc
ctacaaggag ccgacgctgg tgacggccaa cacgctcctc tccatcctcg ccaccgagta ccccgtggag aagctgttcg
tctacatctc cgacgacggc ggcgcgctgc tgaccttcga gtccatggcg gaggcgtgcg cgttcgccaa ggtgtgggtg
cccttctgcc gcaagcacag catcgagccg cgcaacccgg attcctactt cacgcagaag ggcgacccga ccaagggcaa
gaagcggccg gacttcgtca aggaccgccg ctggatcaag cgcgagtacg acgagttcaa gatccgcgtg aacagcctcc
ccgacctcat ccgccgccgc gccaacgccc tgaacgcccg cgagcgcaag ctggcgcgcg acaagcaggc cgccggcgac
gccgacgcac tcgcctccgt gaaggccgcc acctggatgg ccgacggcac gcactggccg ggcacctggc tggacccgtc
ccccgaccac gccaagggcg accacgccag catcgtgcag gtgatgatca agaacccgca ccacgacgtg gtgtacggcg
aggccggcga ccacccgtac ctggacatga ccgacgtgga catgcgcatc ccgatgttcg cctacctgtc gcgggagaag
cgcgccgggt acgaccacaa caagaaggcc ggcgccatga acgccatggt gcgcgcgtcg gcgatcctct ccaatggccc
cttcatgctc aacttcgact gcgaccacta catctacaac tgccaggcca tccgcgaggc catgtgctac atgctcgacc
gcggcggcga ccgcatctgc tacatccagt tcccgcagcg gttcgagggg atcgacccct ccgaccgcta cgccaaccac
aacaccgtct tcttcgacgg caacatgcgc gcgctcgacg gcctccaggg ccccatgtac gtcggcacgg gctgcctctt
ccgccgctac gccatctacg gcttcaaccc gccgcgcgcc atcgagtacc gcggcaccta cggccagacc aaggtgccca
tcgacccgcg acaaggcagc gaagccatgc ccggcgccgg cggcggccgc agcggcggcg gcagcgtggg cggcgaccac
gagctgcagg cgctgtcgac ggcgcacccg gaccacgagg cgccgcagaa gttcggcaag tccaagatgt tcatcgagtc
catcgcggtg gccgagtacc aggggcggcc gctgcaggac cacccgtccg tcctgaacgg tcgccccccc ggcgcgctgc
tgatgccgcg gccgcctctg gacgcggcga cggtggcgga gtcggtgtcg gtgatctcgt gctggtacga ggacaacacg
gagtgggggc agcgcgtggg gtggatctac gggtcggtga cggaggacgt ggtgaccggg taccggatgc acaaccgcgg
gtggcggtcg gtgtactgca tcacccggcg cgacgcgttc cgcgggacgg cgccgatcaa cctgacggac aggctgcacc
aggtgctccg gtgggcgacg gggtcggtgg agatcttctt ctccaagaac aacgcggtgc tggcgtccag gcggctcaag
ttcctgcagc ggatggcgta cctcaacgtt gggatctacc ccttcacgtc gctcttcctc atcatgtact gcctcctccc
ggcgctgtcg ctcttctcgg ggcagttcat cgtggcgacg ctggacccga cgttcctctc ctacctgctg ctcatcacca
tcaccctcat gctgctctgc ctgctggagg tgaagtggtc cgggatcggg ctggaggagt ggtggcggaa cgagcagttc
tgggtgatcg gcggcacgtc ggcgcacctg gcggcggtgc tgcagggcct gctcaaggtg gtggccggga tcgagatctc
cttcacgctc acggccaagg cggcggcgga ggacgacgac gaccccttcg ccgagctcta cctcatcaag tggacgtcgc
tcttcatccc gccgctcgcc gtcatcggga tcaacatcat cgcgctcgtc gtcggcgtgt cgcggacggt gtacgcggag
atcccgcagt acagcaagct gctcggcggc ggcttcttca gcttctgggt gctcgcgcac tactacccgt tcgccaaggg
cctcatgggc cgccgcggcc ggacgcccac catcgtctac gtctgggccg gcctcatctc catcaccgtc tctctcctct
ggatcaccat tagccccccG GATGATAGCG TCGCGCAGGG CGGCATCGAC GTGTGACTTT TCGTGACACA CACCATCACC
CATCACTGGT ACTAAGATCG ATCGAGATAT GCATGGCCAG ACATACAAGA AATTGCCAAG AGATTTATAT GTGCCAATTG
CATGAACCGT GCACTACATG CATCGATCAG ATTTGCACTG TACGTTCAAG ATGTTCTGGT TAGTGTGTCG TGTTGGAGTA
CTGATTTGGT TTTTGTAAGA AAGAATTTGC TGGGTTTATT AGCATGTACG TCCTGTGTTA CTTAAGGATG CCAGAGCAGG
GTCCATTTTG TACAAGAGTT TCCCATGTGT GTACCAATAT ACGGACAGGG CAGTACTGAC TGACTGTACA TGATTTTCTG
TATTTGGGTT CTGGTAAAAT TACCTATTCT TG

Locus: Os06g0336500

Loading...

Locus: Os06g0336500

Loading...