Os06t0355300-01

Locus

Os06g0355300

Description

Similar to Auxin-responsive protein IAA22.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA22

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA22

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 22, INDOLE-3-ACETIC ACID INDUCIBLE 22

Transcript Evidence

AK288467 (DDBJ, Best hit)

Protein Evidence

Q69TU6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J090036N10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0355300-01)

Others

Oryzabase (10910)

KEGG (Os06t0355300-01)

Transcript

2439 bp

>Os06t0355300-01 Similar to Auxin-responsive protein IAA22.
AGTCAGCCCAATGATGCCTCCGAAGTTGCACAACACCAACATAAGGTAATTTCGCCTGCT
TCATTTTTTTTCATGTATGATATGACATTATTTGAAATGAGACTATCAACAATGGCAAAA
AAACATAGCTCCTGTTATTCAGCATGCTTTATTCTTGAAAGCTCATGTATAAGCGTCTTA
TTTGTAACGAGTAATTGCGTTGGGGCGTTGCAAGAATTGATGCATAATTTGAGTCCATTT
TGTCATCAAGTCATGTTGATTGCTCCTCTGTTAGCTGTGCACTCTGTTTTCAGTCACATT
CACATGCACTCCTGCTATGCCTATCATTGCACATCGTGCTGTTTTTGCTTGCTTATTAGC
AGTACTCATCATAGTAGGCTAGAAAACCCTTGTTGCATATCTATGTATCTGTAAAAACAG
AAAAAGAATCTGAACTTTGGTCTGATTGATTAGGACTACAGGAGGCAACAAAACAAAGCC
CAAGCAGGAGAACCACTCATTCTTGCAGAGCAGAGTTGTGTTTTCAGGGGACACCATTTC
TTAATTTGTTCCGTCAACAACAGCGGCAGGTTTCGATGAAGGATAGCTCATTCTTTTGCA
TGATAATGAAACAATCTGTATTTTGTCAGTCCAGTGGCTGCTTATGCTTAGCAGCAGTGG
TTTCGTGTAGATGAAGCTCAAGGCAGCAGCGGTTGTGAGTTGTGACTTTGGCAAAGGAAA
ACTGTACCCTCAAGTCATGGGAGCTGGTTGGAATGAATCAGGGTTAGTTGAAAGAAACAT
TTCTCTGGGCTTCATCATCAGGCTCACTGCCATGATTTTTAGGTACGAAATTAGTTGGGA
GATACCTGTCCATTGTATGGGAATTCTCTTTGTGTACACTTCAATTTTTGTATCAGGCTT
GTCTCTAATTTGTGATGATAATTAATCACATGTCGCCACATTGCGTAGGGTTGTACTGAA
CCCTACCTTATGTATGATTGTATTGTATTGTTGGTGTCAAAGGATTTGATTTAATTAGTA
TTTGGGGTGATTCTTCTTCTGTCGTTCCAACTGCCACCTTACCTGAATTGCCTTCTCAAG
CTCGAACAGAAATTCAATTGGGTAGCATAATTGAGGATTGAATATTGTCACTGAGTATTT
TGTACATTCTCCAATCATCTCTCTTTTGATTGTAAGAGATTGCTCTGGTTCAGTCAGGGG
TATATTTAAGTTGCTCCTTGTTTTGATGTGATCACAACTTGTTCTGGGAGATCATAAAAA
CGCATGACAGCAAACAAGAGAACAGAATACTGCCTGAATGTTCAAAGACAGAATTCGCGC
GTAAAGGGAGGAGATGGAGAAAAAAAAGTTAAACAGAAAGATAAAAGGGAAGCATAAAGA
TGATCTTTATTTTTTTAAAAAAGAAAATAAAAGGAGAGGAAACGGAAAGGAAGCAGAAGG
GGCCATTAGAGCCATCATCATGCAGAAGTAAGAACCTCCATAACTTTAAAGGTGGATGGA
GAAAAGGACCTTCCCATTAGTTTCAGCCTGCAGAGTTGCTGTCATGAAATTCTCATCCAT
TATCTAAAAAATGAAAATTCTCATCAGTATAGAATCTTTGCAGTTAGGGAGGAACAATAA
CAAATGGTTCATGGTAGCACCTATCATGTATCAAAGTTTATTTCTTGTTTGCTACCATGA
ACAATTTACTTAATTTATTTACTATCAATGTTTCCAAAAAGGTTTAGCCTCATCATCTCA
CCAAATTTACTTTATTTACTAACAAAATGTTCAGAGAAAACCGCGCGGCTTCATCAGCTC
AGCTGGTGGGATGGCCACCGGTGCGCACATTCCGCAAGAACCTGTCCACCCCAAAACCTG
CAGATGCAGATGACCTGATGAACAAGATGAAGCCCTGCTCTGATGAAGGCCATGGCTCCA
GAGATGCAGCCCAAGAGAGGAGGCCATCATCAACCATGTTTGTGAAGGTGAACCTGGAGG
GCTACGCTGTCGGAAGGAAGATCGACCTGAAGGCGCACCGCAGCTACGACTCGCTGTCCC
AGGCTCTGCAGAGCATGTTCCATGGCTTCTTGTCAGGTCAAGACCTTTGAGTATTGGATT
GGGAGTGAGCTCCATAGTATTTCTTGCTCAGGTGACTGATCTTGATGTTTGGTTTCAGAT
GGCATTGCAACTAGAGACAATGAGCTGCAGCGGATGGAGGAGGGCAGCAAGAAGAGGTAT
GTTCTTGTGTATGAGGATAATGAGGGAGACCGCATGCTCGTCGGCGACGTCCCATGGGAG
TACGTTTGTTTGCTTTGAGAAACCTCTCATTTCTGACATTTTTTTCCTTTTATCCAACGA
AGAAGATGACATGAAGAGCTGAAAACTGATTGATCGATCTTGCAAATTTTATATATGCAA
GCTGTTCATTGCTTCAGTGAAGAGGCTCTACATTGCTCA

CDS

255 bp

>Os06t0355300-01 Similar to Auxin-responsive protein IAA22.
ATGAAGCTCAAGGCAGCAGCGGTTGTGAGTTGTGACTTTGGCAAAGGAAAACTGTACCCT
CAAGTCATGGGAGCTGGTTGGAATGAATCAGGGTTAGTTGAAAGAAACATTTCTCTGGGC
TTCATCATCAGGCTCACTGCCATGATTTTTAGGTACGAAATTAGTTGGGAGATACCTGTC
CATTGTATGGGAATTCTCTTTGTGTACACTTCAATTTTTGTATCAGGCTTGTCTCTAATT
TGTGATGATAATTAA

Protein

85 aa

>Os06t0355300-01 Similar to Auxin-responsive protein IAA22.
MKLKAAAVVSCDFGKGKLYPQVMGAGWNESGLVERNISLGFIIRLTAMIFRYEISWEIPV
HCMGILFVYTSIFVSGLSLICDDN*

5'UTR

chr06:14577762..14578431 (+ strand) : 670 bp

CDS

chr06:14578432..14578686 (+ strand) : 255 bp

3'UTR

chr06:14578687..14580200 (+ strand) : 1514 bp

FASTA

>Os06t0355300-01 class=Sequence position=chr06:14577762..14580200 (+ strand)
AGTCAGCCCA ATGATGCCTC CGAAGTTGCA CAACACCAAC ATAAGGTAAT TTCGCCTGCT TCATTTTTTT TCATGTATGA
TATGACATTA TTTGAAATGA GACTATCAAC AATGGCAAAA AAACATAGCT CCTGTTATTC AGCATGCTTT ATTCTTGAAA
GCTCATGTAT AAGCGTCTTA TTTGTAACGA GTAATTGCGT TGGGGCGTTG CAAGAATTGA TGCATAATTT GAGTCCATTT
TGTCATCAAG TCATGTTGAT TGCTCCTCTG TTAGCTGTGC ACTCTGTTTT CAGTCACATT CACATGCACT CCTGCTATGC
CTATCATTGC ACATCGTGCT GTTTTTGCTT GCTTATTAGC AGTACTCATC ATAGTAGGCT AGAAAACCCT TGTTGCATAT
CTATGTATCT GTAAAAACAG AAAAAGAATC TGAACTTTGG TCTGATTGAT TAGGACTACA GGAGGCAACA AAACAAAGCC
CAAGCAGGAG AACCACTCAT TCTTGCAGAG CAGAGTTGTG TTTTCAGGGG ACACCATTTC TTAATTTGTT CCGTCAACAA
CAGCGGCAGG TTTCGATGAA GGATAGCTCA TTCTTTTGCA TGATAATGAA ACAATCTGTA TTTTGTCAGT CCAGTGGCTG
CTTATGCTTA GCAGCAGTGG TTTCGTGTAG ATGAAGCTCA AGGCAGCAGC GGTTGTGAGT TGTGACTTTG GCAAAGGAAA
ACTGTACCCT CAAGTCATGG GAGCTGGTTG GAATGAATCA GGGTTAGTTG AAAGAAACAT TTCTCTGGGC TTCATCATCA
GGCTCACTGC CATGATTTTT AGGTACGAAA TTAGTTGGGA GATACCTGTC CATTGTATGG GAATTCTCTT TGTGTACACT
TCAATTTTTG TATCAGGCTT GTCTCTAATT TGTGATGATA ATTAATCACA TGTCGCCACA TTGCGTAGGG TTGTACTGAA
CCCTACCTTA TGTATGATTG TATTGTATTG TTGGTGTCAA AGGATTTGAT TTAATTAGTA TTTGGGGTGA TTCTTCTTCT
GTCGTTCCAA CTGCCACCTT ACCTGAATTG CCTTCTCAAG CTCGAACAGA AATTCAATTG GGTAGCATAA TTGAGGATTG
AATATTGTCA CTGAGTATTT TGTACATTCT CCAATCATCT CTCTTTTGAT TGTAAGAGAT TGCTCTGGTT CAGTCAGGGG
TATATTTAAG TTGCTCCTTG TTTTGATGTG ATCACAACTT GTTCTGGGAG ATCATAAAAA CGCATGACAG CAAACAAGAG
AACAGAATAC TGCCTGAATG TTCAAAGACA GAATTCGCGC GTAAAGGGAG GAGATGGAGA AAAAAAAGTT AAACAGAAAG
ATAAAAGGGA AGCATAAAGA TGATCTTTAT TTTTTTAAAA AAGAAAATAA AAGGAGAGGA AACGGAAAGG AAGCAGAAGG
GGCCATTAGA GCCATCATCA TGCAGAAGTA AGAACCTCCA TAACTTTAAA GGTGGATGGA GAAAAGGACC TTCCCATTAG
TTTCAGCCTG CAGAGTTGCT GTCATGAAAT TCTCATCCAT TATCTAAAAA ATGAAAATTC TCATCAGTAT AGAATCTTTG
CAGTTAGGGA GGAACAATAA CAAATGGTTC ATGGTAGCAC CTATCATGTA TCAAAGTTTA TTTCTTGTTT GCTACCATGA
ACAATTTACT TAATTTATTT ACTATCAATG TTTCCAAAAA GGTTTAGCCT CATCATCTCA CCAAATTTAC TTTATTTACT
AACAAAATGT TCAGAGAAAA CCGCGCGGCT TCATCAGCTC AGCTGGTGGG ATGGCCACCG GTGCGCACAT TCCGCAAGAA
CCTGTCCACC CCAAAACCTG CAGATGCAGA TGACCTGATG AACAAGATGA AGCCCTGCTC TGATGAAGGC CATGGCTCCA
GAGATGCAGC CCAAGAGAGG AGGCCATCAT CAACCATGTT TGTGAAGGTG AACCTGGAGG GCTACGCTGT CGGAAGGAAG
ATCGACCTGA AGGCGCACCG CAGCTACGAC TCGCTGTCCC AGGCTCTGCA GAGCATGTTC CATGGCTTCT TGTCAGGTCA
AGACCTTTGA GTATTGGATT GGGAGTGAGC TCCATAGTAT TTCTTGCTCA GGTGACTGAT CTTGATGTTT GGTTTCAGAT
GGCATTGCAA CTAGAGACAA TGAGCTGCAG CGGATGGAGG AGGGCAGCAA GAAGAGGTAT GTTCTTGTGT ATGAGGATAA
TGAGGGAGAC CGCATGCTCG TCGGCGACGT CCCATGGGAG TACGTTTGTT TGCTTTGAGA AACCTCTCAT TTCTGACATT
TTTTTCCTTT TATCCAACGA AGAAGATGAC ATGAAGAGCT GAAAACTGAT TGATCGATCT TGCAAATTTT ATATATGCAA
GCTGTTCATT GCTTCAGTGA AGAGGCTCTA CATTGCTCA

Locus: Os06g0355300

Loading...

Locus: Os06g0355300

Loading...