Os06t0480000-01

Locus

Os06g0480000

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPUB74

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 74, U-box protein 74

Transcript Evidence

AK066627 (DDBJ, Best hit)

Protein Evidence

B6SV52 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

U box domain (IPR003613)

Armadillo-like helical (IPR011989)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Armadillo-type fold (IPR016024)

Full-length cDNA

J013072C11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0480000-01)

RiceXPro (AK066627)

Others

Oryzabase (17863)

KEGG (Os06t0480000-01)

Transcript

3166 bp

>Os06t0480000-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ACCATTAACTCCCCACTCACTCTCACGTCTCACCGGCGCAGGAAGGAGAAGTCCTCGTGT
TTCGTCCTCTCTCCCTCCTCGATCCTACCCCTTGCCGGCGTCTTGCTTCTCCTCCTCCCA
CTTGAGCGGCAGCCGTCGCCGTGATGTAGCAGGCAGTCCCGCCGAATCGATCCCGCGGTA
GCTAGCTAGCTGCAGGCTGCAGCAGCTAAGTCCAACAATTTTAGGGGGGAAGAACCCAAT
CTTGTGAACGAAAGAACTAGTCTGGGTCAGCCAAGAATCCAGCCAAGATTATTTCTATCT
GTCCCGCGGGGGCAGTTTAAGGTTTCTTCATCTGCTCCAGAAACTCAGGACAGAAGCAGT
TTACTGATTATAATCACTTTTGCTCTCTGGGACAAGAAAGGAAGAGGGGCAAATCCAAAA
GAGTTTGATACTTTTATCACGGATTACTGTTAGTCGATGGAGAATAATAATGATGGAGTG
ATTGGAATATCCTGGCGTAATTCTAATCCAAAGGTTCACAGCTCAATGTGCAGTGAATTG
ACAATGATGTTAGATAAAGTCTCTTCTATTCTTCCCTCAATCGAAACTGCTCAACCAGGA
TGTAAAGCGGGTATAGAGGAACTATGCAACCTGTACAACATAGTTGACAAAGGAAAACTC
ATAATCCAGAACTGCATTGAGTGCAGTAGTCTTTACTTGGCTATTACAGGGGAGGCAACT
GCAATGCGGTGCGAAAGGATAAGAGATGCGCTGAGGCGAAGCTTGTTCCTGGTTCAGAAT
ATGGTCCCGTCATCATTAGCTAATCAGGTGGCTGATGTTCATGATGATCTTGGGGATGTG
AAATTCATTGTTGACCCAGAAGAAGATGAGGCTGGCAAAGCCATTTTGGAGATGCTTCGG
CAGTCTGATGCAACCCAAGAACATGAACTCCAGACTTTCTTGTTTGCAGCGTCAAAGTTA
AATTTGACGTCACCAAAGGCTATCTTAATTGAAAGACGAGCAATCAAGAAACTACTGGAC
AAGATCAATGGTAATGATCCCAAAAAGGAAGGAATACTCAAATTTTTTCAATATCTAGTT
AGGAAATATGGAAAGACTATGAAGCCTGAGGGTAGTGCAAAGAATGAAGGTGTGGATGTT
GCAAACGTTACTTCGAGTACAAACCTAATTGCTAGTGGTACCGATGCTCCACAGAAATGC
TTTTCACCTACAAACTCTTGGACTGGAAGATGTGAAGAGCAGAATAATTTGTCACGATTT
TCTACTCCTCCAGAGTTCTGCTGCCCACTATCTATGAAGCTGATGTACGATCCTGTGATA
ATAGCATCTGGACAAACCTATGAGAGAGAGAACATTGAGAAATGGTTCAGTGAGGGATAT
GATATTTGTCCTAGGACACAGTTAAAGTTAGAAAATTTCACGATTACTCCAAATACTTGT
ATGAAGGCTGTGATCTGCAACTGGTGCAAAGATAATGAGCTTGAATTCACTTCTTTACCT
GAACAATTTCATAGTTACTCTGTTTCAAGTCTACACAATATCTCAGCACCTCTAGTTGCT
GGAACAAAGAGAGATTACATGTCTGATCATAGCAGTTCATCTGTTGCATTATCTGGTTCT
AGTTATGTATCATCTCCAATGCGGGAAACAGAAGAGTCAAGGACTAATTCTACTCAGTTT
TTTTCAAACGCTTATTACCAGTTGTATTTGTCCTTCAGCAGCTTCAACAAGGAGATGTTT
CTGAATTTCTTTTACGAGCTGTCCGAGCTTCCAATGGAACTTCAAGTGAAGGCTGTCAGA
GATTTCAAAAGTGTTCTGAATCGTGAATATCAAATTTGGCGTTCTATGATTTCCAATGGT
TTTTTAGAAGCATTTCTTGAGTTTCTTAAGAACGATAATGGAAAATGCACAATGGAAGCT
CAAAGAACTGGCATTCAGTTTTTTCTTGCTTTTCTACGTAATAGCAGGACCCGAATTCCA
TCCATTAGTGAAGATGCAGTGCGTCTCGTTGCTTCATTTCTTGATTCAGAGTTAAAAACT
GAAGCATTGGAGATACTCCATGAACTGCTGCAGCAACCAAGTTGTCGGAAATCTCGTCTC
ATGGCATCTGTTGTTGCTCCATCTGTGTTTCTAGCTTGGGATAGTGCAGACTCCCTGTGC
CTAGAACTAGTTTTGAAGATCATCTGCGAGCTTTCATTCAAAAATGATGTACAATCTTTC
CTAATTTCTTCTGGAATAATCTCAAAGCTATCTCCAATTCTCAGTCAAGGGAAATCGCCT
GAGTGTTGCCTAAAGATTCTACTAAATTTAAGTGAAGGGAAACAAGCTGCGGATCTCATT
ATCAGAACTGATCAATGCCTCAGTTCTATTTCAGATTATCTGGACACAGGAAGCTCCGTG
GAACGCGAGCATGCGTCAGGTATCCTTCTTGCCTTATGCTCTCGCAGCATCGACGATTGT
GTTCTTGTCATGAAGGAAGGTGTCATCCCTGCGCTGGTCGATTTGTCGGTCAATGGAACT
GAGGTTGCAAAGGCTTCTTCAATCAAGTTGCTTCAACTTCTCAGGGACTCTAGACAAAGC
GACCAGTTTGGCAATTCATGTTCAAGTGAGGTGGCTGTCAATGGTGCAGCAGAGAATTCG
CCCATTGGCACGATCTGCAAACAACCAATATCAAAATCAGCTCGGTATATCTCAAGAAAG
CTCAGCATTTTCTCGAAACCTCGATCGCTGACCCTCGTCTGATGAGTCGAGTTTGATTTT
GGTTGGAGCTTTGTACATTTTCAAACACTGCCCAACCAGCTGGTGTACAGTTTGTAGCAG
ATAGTAGTGTCCAGATGAAATGCTTGATGGGATGTTTTTTCAACCCCATGTACTAGTGTT
TCTTCTAGAGTTTGTATTTGCAGTACTTTTGCTTTTCTTTACTAGGTTGTTTTAGATAAA
GACATACGGTGAACAGGTTTTATGTCGAAAGTTGCATTTTATTCTCTGCTGTTGCATATA
CAGTTGAAAATCTGAAGGGGCAGGCAGCACATGTCAGTCTGAAGGATGCAACACCTTTGA
TAATATGGCGTCTTTGTTATGTGTGTGTGTGCGTGTGTGTATTTAAAAGGATGAATAGTC
GAAGTTTAAATATGAATAGTATTCGGTTACCGTATACTTTATTTCC

CDS

2286 bp

>Os06t0480000-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGAGAATAATAATGATGGAGTGATTGGAATATCCTGGCGTAATTCTAATCCAAAGGTT
CACAGCTCAATGTGCAGTGAATTGACAATGATGTTAGATAAAGTCTCTTCTATTCTTCCC
TCAATCGAAACTGCTCAACCAGGATGTAAAGCGGGTATAGAGGAACTATGCAACCTGTAC
AACATAGTTGACAAAGGAAAACTCATAATCCAGAACTGCATTGAGTGCAGTAGTCTTTAC
TTGGCTATTACAGGGGAGGCAACTGCAATGCGGTGCGAAAGGATAAGAGATGCGCTGAGG
CGAAGCTTGTTCCTGGTTCAGAATATGGTCCCGTCATCATTAGCTAATCAGGTGGCTGAT
GTTCATGATGATCTTGGGGATGTGAAATTCATTGTTGACCCAGAAGAAGATGAGGCTGGC
AAAGCCATTTTGGAGATGCTTCGGCAGTCTGATGCAACCCAAGAACATGAACTCCAGACT
TTCTTGTTTGCAGCGTCAAAGTTAAATTTGACGTCACCAAAGGCTATCTTAATTGAAAGA
CGAGCAATCAAGAAACTACTGGACAAGATCAATGGTAATGATCCCAAAAAGGAAGGAATA
CTCAAATTTTTTCAATATCTAGTTAGGAAATATGGAAAGACTATGAAGCCTGAGGGTAGT
GCAAAGAATGAAGGTGTGGATGTTGCAAACGTTACTTCGAGTACAAACCTAATTGCTAGT
GGTACCGATGCTCCACAGAAATGCTTTTCACCTACAAACTCTTGGACTGGAAGATGTGAA
GAGCAGAATAATTTGTCACGATTTTCTACTCCTCCAGAGTTCTGCTGCCCACTATCTATG
AAGCTGATGTACGATCCTGTGATAATAGCATCTGGACAAACCTATGAGAGAGAGAACATT
GAGAAATGGTTCAGTGAGGGATATGATATTTGTCCTAGGACACAGTTAAAGTTAGAAAAT
TTCACGATTACTCCAAATACTTGTATGAAGGCTGTGATCTGCAACTGGTGCAAAGATAAT
GAGCTTGAATTCACTTCTTTACCTGAACAATTTCATAGTTACTCTGTTTCAAGTCTACAC
AATATCTCAGCACCTCTAGTTGCTGGAACAAAGAGAGATTACATGTCTGATCATAGCAGT
TCATCTGTTGCATTATCTGGTTCTAGTTATGTATCATCTCCAATGCGGGAAACAGAAGAG
TCAAGGACTAATTCTACTCAGTTTTTTTCAAACGCTTATTACCAGTTGTATTTGTCCTTC
AGCAGCTTCAACAAGGAGATGTTTCTGAATTTCTTTTACGAGCTGTCCGAGCTTCCAATG
GAACTTCAAGTGAAGGCTGTCAGAGATTTCAAAAGTGTTCTGAATCGTGAATATCAAATT
TGGCGTTCTATGATTTCCAATGGTTTTTTAGAAGCATTTCTTGAGTTTCTTAAGAACGAT
AATGGAAAATGCACAATGGAAGCTCAAAGAACTGGCATTCAGTTTTTTCTTGCTTTTCTA
CGTAATAGCAGGACCCGAATTCCATCCATTAGTGAAGATGCAGTGCGTCTCGTTGCTTCA
TTTCTTGATTCAGAGTTAAAAACTGAAGCATTGGAGATACTCCATGAACTGCTGCAGCAA
CCAAGTTGTCGGAAATCTCGTCTCATGGCATCTGTTGTTGCTCCATCTGTGTTTCTAGCT
TGGGATAGTGCAGACTCCCTGTGCCTAGAACTAGTTTTGAAGATCATCTGCGAGCTTTCA
TTCAAAAATGATGTACAATCTTTCCTAATTTCTTCTGGAATAATCTCAAAGCTATCTCCA
ATTCTCAGTCAAGGGAAATCGCCTGAGTGTTGCCTAAAGATTCTACTAAATTTAAGTGAA
GGGAAACAAGCTGCGGATCTCATTATCAGAACTGATCAATGCCTCAGTTCTATTTCAGAT
TATCTGGACACAGGAAGCTCCGTGGAACGCGAGCATGCGTCAGGTATCCTTCTTGCCTTA
TGCTCTCGCAGCATCGACGATTGTGTTCTTGTCATGAAGGAAGGTGTCATCCCTGCGCTG
GTCGATTTGTCGGTCAATGGAACTGAGGTTGCAAAGGCTTCTTCAATCAAGTTGCTTCAA
CTTCTCAGGGACTCTAGACAAAGCGACCAGTTTGGCAATTCATGTTCAAGTGAGGTGGCT
GTCAATGGTGCAGCAGAGAATTCGCCCATTGGCACGATCTGCAAACAACCAATATCAAAA
TCAGCTCGGTATATCTCAAGAAAGCTCAGCATTTTCTCGAAACCTCGATCGCTGACCCTC
GTCTGA

Protein

762 aa

>Os06t0480000-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MENNNDGVIGISWRNSNPKVHSSMCSELTMMLDKVSSILPSIETAQPGCKAGIEELCNLY
NIVDKGKLIIQNCIECSSLYLAITGEATAMRCERIRDALRRSLFLVQNMVPSSLANQVAD
VHDDLGDVKFIVDPEEDEAGKAILEMLRQSDATQEHELQTFLFAASKLNLTSPKAILIER
RAIKKLLDKINGNDPKKEGILKFFQYLVRKYGKTMKPEGSAKNEGVDVANVTSSTNLIAS
GTDAPQKCFSPTNSWTGRCEEQNNLSRFSTPPEFCCPLSMKLMYDPVIIASGQTYERENI
EKWFSEGYDICPRTQLKLENFTITPNTCMKAVICNWCKDNELEFTSLPEQFHSYSVSSLH
NISAPLVAGTKRDYMSDHSSSSVALSGSSYVSSPMRETEESRTNSTQFFSNAYYQLYLSF
SSFNKEMFLNFFYELSELPMELQVKAVRDFKSVLNREYQIWRSMISNGFLEAFLEFLKND
NGKCTMEAQRTGIQFFLAFLRNSRTRIPSISEDAVRLVASFLDSELKTEALEILHELLQQ
PSCRKSRLMASVVAPSVFLAWDSADSLCLELVLKIICELSFKNDVQSFLISSGIISKLSP
ILSQGKSPECCLKILLNLSEGKQAADLIIRTDQCLSSISDYLDTGSSVEREHASGILLAL
CSRSIDDCVLVMKEGVIPALVDLSVNGTEVAKASSIKLLQLLRDSRQSDQFGNSCSSEVA
VNGAAENSPIGTICKQPISKSARYISRKLSIFSKPRSLTLV*

5'UTR

chr06:16270527..16270836 (- strand) : 310 bp

chr06:16270384..16270439 (- strand) : 56 bp

chr06:16270192..16270248 (- strand) : 57 bp

chr06:16268544..16268576 (- strand) : 33 bp

CDS

chr06:16268487..16268543 (- strand) : 57 bp

chr06:16267632..16267817 (- strand) : 186 bp

chr06:16267378..16267485 (- strand) : 108 bp

chr06:16265770..16266929 (- strand) : 1160 bp

chr06:16264680..16265454 (- strand) : 775 bp

3'UTR

chr06:16264256..16264679 (- strand) : 424 bp

FASTA

>Os06t0480000-01 class=Sequence position=chr06:16264256..16270836 (- strand)
ACCATTAACT CCCCACTCAC TCTCACGTCT CACCGGCGCA GGAAGGAGAA GTCCTCGTGT TTCGTCCTCT CTCCCTCCTC
GATCCTACCC CTTGCCGGCG TCTTGCTTCT CCTCCTCCCA CTTGAGCGGC AGCCGTCGCC GTGATGTAGC AGGCAGTCCC
GCCGAATCGA TCCCGCGGTA GCTAGCTAGC TGCAGGCTGC AGCAGCTAAG TCCAACAATT TTAGGGGGGA AGAACCCAAT
CTTGTGAACG AAAGAACTAG TCTGGGTCAG CCAAGAATCC AGCCAAGATT ATTTCTATCT GTCCCGCGGG GTGAGGGTTC
CAACCTGTCT TGTTTCTTCT TTACTTTTTT CTTTCTTTTT TCTCAGCATC TATTGAATGT TTCCTCTGCT TAATTAGGGC
AGTTTAAGGT TTCTTCATCT GCTCCAGAAA CTCAGGACAG AAGCAGTTTA CTGGTACTCT TTTGTTCTGT TACATCCCTT
TTTATTTTTA ATTTTTTTTT AAAAAAAAGA GTCAGTTTTT ACATGTTAAA TTATTTTTTT TGCGCATGAA TCACTGTTTT
TTTAGGCTAT CTTTGTGTAT TCCAGCAGAT TATAATCACT TTTGCTCTCT GGGACAAGAA AGGAAGAGGG GCAAATCCAA
AAGAGGTCAG TTTCTTCCTC AAGTTTCACC TTCTGCTGAG CTTTGTTTTG CTAAATTCTT TTGTTGATTA TCCGCTGGAG
TTCGCTTGTG GGTGCCTATC TTCTCAGCTC TTCCTCAGCA GTATTCTGAG TTGCTTATTG CTCTGCATAT AGATGTAGAG
AACGAAATTT CAAAAATAAA GCCTTTTTAC TTTTTGAGTT CAAATCTCTC TATTCCGAAT CTCTTGTTCT CTAGGCCACT
ATACTTTTTC TCCTTTACCT TTTCCCTTTA TGTACTTATC TGCTTGCTTA GGATTAGTGC TCTGTTAATT TTATCTGTTT
AAAAAATATT TACTTTCGTA CCGCTTCCCT TCTTTTTCGT GTATGAGCTC TCTGTTATCC TTTAGGTTGG AAATTCCATC
ATATGGTACA GCATATTCCC ACTAAAGAAA AGGGTACAGT ATAATTGACC TTTCAAAACA AAAAAAAAAA GGTGGTCCTA
CACTCCTACT GACTACGATT GATCGTCTAC AATCTAGATA CATAGTGGCA AGTGATAATT ATTTTCTTTT GGAAGAATTT
AGTTACGTTT GCAATTTTTT TTGGTTCACT CGAATGATTT CTTTTCCAGT AAATATAGAA TACCAAGATT GTGAAGCATG
TATTAGAGAG AAATTATTTG ATTGGCACCA ACCAATTGGC ACTGAGTTGT TACAGGTGCT TAAAAATATA TTATTTTTAT
CCCCGCATAA TCTTTTTATG TTAAGAAATT TTTTTTTAAC CAAACAGTTC CTTAACATAA TATGCATATT TCTCTTGGAG
CATTGTAGAT CTTCTGTAAA TATCTTATTC ATGTCAATTA TATTTAGAGA CTCCAATAGA CCATAGAAGC TTATATGTCT
TCTGAAATAC AATTTTTTTG TGGAATGGTA GAATTGTTTT TAAAAAATAA ATATAGTAAG AAAGTTTAGT GTTATTATCT
GCTAGGTTAA TCTGAAAACT TCCAACTGTC AAGAAAGATT TTTGAAAAAC AAATCAGCAT TCAGACCAAT TAATCAACTT
TCACCTATAG TTGGATCTGA TGTTGAAATC AGAATCACTC TTCAATTTGC ACCGATCTCC TGTGTTATTA ATAGTCTTTA
GTCTAAGATT TGACCCTGCT GTACATGTTC GGCTTAGAAT TTGAGTACAT CACCTTGAAC TGCATTGGAC AATGTGTGTT
GGACCTAGAT AGTCACCACC AGGAGTACGT ATGATAAACT GTACTACTTC AAATATCAAT TTGGTTTTTT TCTTCCTGCT
GTACTAACAT AAAAAAAATC CTAATTGCAA ATAAAAAGAC GAAAAAGCTG AGCACTTGCT TTTTTTTATT TGCATGACTC
ACGTACAAAT ACAAAAAGGA TATCTACAAT AAGTTAAGAA AAGTTCAGAT AAAGTTCAAC TGACTGCTTA GCTTGATGTG
GCGTAACCTT TCTGCCTGTT TTGACAATGT TCCTTTATTT GCATCTTGCT TTAATATGAT CCTATAGCAC AAGCCCCCAA
GGTTCTCGAT TGCCATACAA TTGATAGTAT TTTGTAGCTA TGATCATTTT GGTATTTTCT GCTGATATTG TTATACTGTA
TGTTGACTCT TATTGGGCAG TTTGATACTT TTATCACGGA TTACTGTTAG TCGATGGAGA ATAATAATGA TGGAGTGATT
GGAATATCCT GGCGTAATTC TAATCCAAAG GTATGGATAT TGGACCGCTG AAACTTTCAT CTTTTAGTAA TGTTTCTTGT
TACCTGTTGC CGTCCATGTT TTGTTTGGAA TATAGGTTCT TATGATATTG CTTTATCATT TGCATTATTT GATTGGTTGG
AAATAGTTTT ACGTTGCTTT CTTAGTACCA GAAAGATCTA TGGGTATGAA ATTTGAGTTC TTTAAGGTTT TATCCCTGAG
TAAATATCAT TAATTGTGTA ACATGCACAC AAATCTTAGA CTACACATCA CTATAGATGG TAAATGCTGT GTAAAATTGT
GACTCCATGG CAAAGAATTT GAGACTACCT CAATTGGTCA CATATCCAGT TCAAATTTGG GAGTGTTTTC TTTGTCTGAT
TCAAGATAGA TGCACAATAA TTTCCTCATA AAGATCATAT CTTTGTATGG CATAAAGAAC ATATCTTTGA TACAAACATT
TTTTCTTGCA TGCTTATCTA TGATATGATG TGATTCCTTT GTACCTGTTG AGAGGCAGAG TTAAAACTGC AGTATTTCAA
TAAGATCATT ATTTGATGTT TCATATAAAT ATTATCATTT ACTTCATAGA TAGTTTTCAG TAGTGATTAT CTCCCCATTA
TATATTCTTC AACATTTTAT TACAGTTAAT GCAATTATTC TTTTGTCTTT CTGTCTTAGG TTCACAGCTC AATGTGCAGT
GAATTGACAA TGATGTTAGA TAAAGTCTCT TCTATTCTTC CCTCAATCGA AACTGCTCAA CCAGGATGTA AAGCGGGTAT
AGAGGAACTA TGCAACCTGT ACAACATAGT TGACAAAGGA AAACTCATAA TCCAGAACTG CATTGAGTGC AGTAGTCTTT
ACTTGGTATG TTGTTCTTTA ATATTGATAA ATGAGTCATT ATGTTCAGGA AACTATAATG ACTCCTTTGT TTTTATCTTA
TTGTTTTATT TGAGATTGTT TTCCCTGGTT TCTGAACAAT TGCTTTCTGA TACCAAATTT GCACATCTCA GGCTATTACA
GGGGAGGCAA CTGCAATGCG GTGCGAAAGG ATAAGAGATG CGCTGAGGCG AAGCTTGTTC CTGGTTCAGA ATATGGTCCC
GTCATCATTA GCTAATCAGG TTAGTTTACT TAATTGAACT GATAATAACA GGCAAACTTT TTCTACATTG CACAGCATTA
ACCACATGGT TTGCTGTGTT AAAAGTTTGA AGCTAGTGAT GACACAAACA ACATCAAACT TGCGTCTGTA ATAGAGATGA
AGCTCTCCTT GGACAGTACT TGCGTCTGTT ATTTCTGGGG CATCAACAAA ACCTAACAAT TTCAGGATAT TATTCACAAA
CATTTATCTG GAGGTTTAGA CAGTACTGTA TCCAGAAACA TGATCTATGT TTTTTGTTGT TTCTCCAAAA GATTTTTTAG
ATTACATGGC AGATGTGTGA GTATAAACAC ACACATCAAt tctcaggaca attgtatcat ctcgatgcaa tttaatgagt
tcttccatta tctaaatatc GCACAGATTG TCACATTAAC ATGTTTATAC TTGACTATTT GTCTTAGGTG GCTGATGTTC
ATGATGATCT TGGGGATGTG AAATTCATTG TTGACCCAGA AGAAGATGAG GCTGGCAAAG CCATTTTGGA GATGCTTCGG
CAGTCTGATG CAACCCAAGA ACATGAACTC CAGACTTTCT TGTTTGCAGC GTCAAAGTTA AATTTGACGT CACCAAAGGC
TATCTTAATT GAAAGACGAG CAATCAAGAA ACTACTGGAC AAGATCAATG GTAATGATCC CAAAAAGGAA GGAATACTCA
AATTTTTTCA ATATCTAGTT AGGAAATATG GAAAGACTAT GAAGCCTGAG GGTAGTGCAA AGAATGAAGG TGTGGATGTT
GCAAACGTTA CTTCGAGTAC AAACCTAATT GCTAGTGGTA CCGATGCTCC ACAGAAATGC TTTTCACCTA CAAACTCTTG
GACTGGAAGA TGTGAAGAGC AGAATAATTT GTCACGATTT TCTACTCCTC CAGAGTTCTG CTGCCCACTA TCTATGAAGC
TGATGTACGA TCCTGTGATA ATAGCATCTG GACAAACCTA TGAGAGAGAG AACATTGAGA AATGGTTCAG TGAGGGATAT
GATATTTGTC CTAGGACACA GTTAAAGTTA GAAAATTTCA CGATTACTCC AAATACTTGT ATGAAGGCTG TGATCTGCAA
CTGGTGCAAA GATAATGAGC TTGAATTCAC TTCTTTACCT GAACAATTTC ATAGTTACTC TGTTTCAAGT CTACACAATA
TCTCAGCACC TCTAGTTGCT GGAACAAAGA GAGATTACAT GTCTGATCAT AGCAGTTCAT CTGTTGCATT ATCTGGTTCT
AGTTATGTAT CATCTCCAAT GCGGGAAACA GAAGAGTCAA GGACTAATTC TACTCAGTTT TTTTCAAACG CTTATTACCA
GTTGTATTTG TCCTTCAGCA GCTTCAACAA GGAGATGTTT CTGAATTTCT TTTACGAGCT GTCCGAGCTT CCAATGGAAC
TTCAAGTGAA GGCTGTCAGA GATTTCAAAA GTGTTCTGAA TCGTGAATAT CAAATTTGGC GTTCTATGAT TTCCAATGGT
TTTTTAGAAG CATTTCTTGA GTTTCTTAAG AACGATAATG GAAAATGCAC AATGGAAGCT CAAAGAACTG GCATTCAGTT
TTTTCTTGCT TTTCTACGTA ATAGCAGGTG AGCATTCTTG TATAATATAT TCTCCTTGTG TTTGGCTGTG TACAACCATG
TTGGATGTAG AGCTCTGGTT TTAATTCATT AATTATCTAA AAATCTCCTT GTGCAGATTT TACTGTTGAC AAACATAAGA
TATTTCCTGT TTCTACCTTT TTCAATAAAA ATCCATAAAT AAAACTGAGT GCCCTATATT TATCCTCCAA AAACGAAGAT
TGTTTTGTGC TACTTTTTAA AAACAAAGGG TTCAGATTAT GGCAATTTGT TTTGTTTGTT CTCCAATAAA CTTTTGTAAC
GGCTGATTTC CTTTTCATAC AGGACCCGAA TTCCATCCAT TAGTGAAGAT GCAGTGCGTC TCGTTGCTTC ATTTCTTGAT
TCAGAGTTAA AAACTGAAGC ATTGGAGATA CTCCATGAAC TGCTGCAGCA ACCAAGTTGT CGGAAATCTC GTCTCATGGC
ATCTGTTGTT GCTCCATCTG TGTTTCTAGC TTGGGATAGT GCAGACTCCC TGTGCCTAGA ACTAGTTTTG AAGATCATCT
GCGAGCTTTC ATTCAAAAAT GATGTACAAT CTTTCCTAAT TTCTTCTGGA ATAATCTCAA AGCTATCTCC AATTCTCAGT
CAAGGGAAAT CGCCTGAGTG TTGCCTAAAG ATTCTACTAA ATTTAAGTGA AGGGAAACAA GCTGCGGATC TCATTATCAG
AACTGATCAA TGCCTCAGTT CTATTTCAGA TTATCTGGAC ACAGGAAGCT CCGTGGAACG CGAGCATGCG TCAGGTATCC
TTCTTGCCTT ATGCTCTCGC AGCATCGACG ATTGTGTTCT TGTCATGAAG GAAGGTGTCA TCCCTGCGCT GGTCGATTTG
TCGGTCAATG GAACTGAGGT TGCAAAGGCT TCTTCAATCA AGTTGCTTCA ACTTCTCAGG GACTCTAGAC AAAGCGACCA
GTTTGGCAAT TCATGTTCAA GTGAGGTGGC TGTCAATGGT GCAGCAGAGA ATTCGCCCAT TGGCACGATC TGCAAACAAC
CAATATCAAA ATCAGCTCGG TATATCTCAA GAAAGCTCAG CATTTTCTCG AAACCTCGAT CGCTGACCCT CGTCTGATGA
GTCGAGTTTG ATTTTGGTTG GAGCTTTGTA CATTTTCAAA CACTGCCCAA CCAGCTGGTG TACAGTTTGT AGCAGATAGT
AGTGTCCAGA TGAAATGCTT GATGGGATGT TTTTTCAACC CCATGTACTA GTGTTTCTTC TAGAGTTTGT ATTTGCAGTA
CTTTTGCTTT TCTTTACTAG GTTGTTTTAG ATAAAGACAT ACGGTGAACA GGTTTTATGT CGAAAGTTGC ATTTTATTCT
CTGCTGTTGC ATATACAGTT GAAAATCTGA AGGGGCAGGC AGCACATGTC AGTCTGAAGG ATGCAACACC TTTGATAATA
TGGCGTCTTT GTTATGTGTG TGTGTGCGTG TGTGTATTTA AAAGGATGAA TAGTCGAAGT TTAAATATGA ATAGTATTCG
GTTACCGTAT ACTTTATTTC C

Locus: Os06g0480000

Loading...

Locus: Os06g0480000

Loading...