Os06t0487900-02

Locus

Os06g0487900

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

OTS1

CGSNL Gene Name

OVERLY TOLERANT TO SALT1

Oryzabase Gene Symbol Synonym(s)

OsOTS1

Oryzabase Gene Name Synonym(s)

Overly Tolerant to Salt 1

Transcript Evidence

AK121622 (DDBJ, Best hit)

Protein Evidence

B8B2F9 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033045C16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0487900-02)

RiceXPro (AK121622)

Others

Oryzabase (20932)

KEGG (Os06t0487900-02)

Transcript

4278 bp

>Os06t0487900-02 Hypothetical conserved gene.
GTAGGGGGTAGAGTAGGGGAATCCGCGCCGCCTCCTGCTCCTGGCCGCCGTGAATGCTAT
GGCcggcggcgaggacggggccgacggcgtcggagatgacaccgagcttcgcaggttctc
agacgtggagctgctggagaagtcgcggcgcattcagggggagctcagtgggggtatcga
gcgaaggctcaaggaccgcggggccaagtttcgccgcttgctagacgccatcgtcCGCGA
GATTGATCGCCGTAAGGCAGCAACGGATGATGACAGATGCGCAAGGGTAGTTCAATCGGG
ATGTGCAGAATCATCAGTTAAACAACAAGCAGTAACCATATCAGATTTTCGGTCCTCCTT
TGGGATAGATGAAGAGGCAGGCGTTGATGTATCTCATTTGGAAACAAGTGCATGCATTGG
CGACCCAAAAACTTCAACAGATAATGAGGGGATCTTGTGTGAAGAGGAAGATTCCTATGC
TGCTGATGATGGCAAGGATAATGGCTACAGTAGGATATGCAAAGATGCCCACACTTCTAG
GAAAAGGAATGGAGAATTTTCACCTACCTTTTCAATGCGATTGCGATCAAGAAAGGTTAG
TATGTACATTTTCCTTTCCAAACATCGTGACATGGTATACTAGTAGTAATTTTTATGTTG
AATACTAAAGTTCTAGTAATACAGTTGGCAGAGGTCCACCACCCCTATTATTGCCAGTAC
ATAAATTAGTTGATTTGTTTTTTGACTATCTGTTATGGTGGTCAATAACATGGAAAGATT
AATTATATTTTCTAACTGGGAAAAAGGAAATATTTATTTGCAATGATATTATCATCTTCT
CGCTCACTATCAAAGAATGAACCTTACTGCCCTAAAGGCTCCTCCTTTTAACTGAATTGT
GATAAATTTGTGAAGTTCCGTTTGCTGATGTGTGGTTGATTCTGTTATTACCAAGCTTGA
TGATAAATTGTTGATTAGATGATTGTACACGCTGTGTTTTATCTTCGTGTCAAGTGAATT
GTTATTTTTCATGCATGCTCATTGAGTTTTTTATACTTTGACCATTTTCGCATTCCTTCA
TTTCACAAATACATGCCATTTCAGATGTTACCATAGTTTCTAATCTACAGCTTTGTGTAC
TAATTTCAGTAGTAATATGCTGGTAAAAACTATAAGATATGTTACTACAAAATGTATTCC
TTTTGAGAATCTATTAATATTATTTCCATATAAACTGATTAGATACCTTTTTTTGTTATA
ACATTGGTGCTGATTTCTAGTATGCAACTATGCATTACTAAAATTGGAATTTATTTGTAA
TATGTGACATTTAGAAGGAAAGACATAGAAAACCGGTTATTTTCTAAGTAACTACGATTA
GAATAAGGATTCTGCTCCAATTAGAATCAAGATGGACCCTGTACAACATGGTTCTATGGT
AACAATAGAGTCCTAGGATTGTACTATTAAAAGCCTTTTTTTGAACCTTGTGGCAACAAG
GGGTTCGGGGGATTATGTAAACAAAAAGGCAGGAGGGGTGgtcgaacagagacgaaagtc
ggccatagtgatccgggagtcccgtgtggaagggctctcgctcaacggatcaaaggtacg
ccggggataacaggctgatgactcccaagagctcttatcgacggagttgtttggcacctc
gatgtcgactcatcacatcctggggttgaagaaggtcccaagggttcggtctcttagttg
aggagtggtGGCATGGGATCTCTAATTCTCCCCCATGTTCATGCATATGGGGCATTTTGA
GTTTGTTCTGTGGTGTGAACGTTTTTTTGCTCTTATTTTTCTTAACAAACAACAAAATTT
TCTGGGTTTTTAAATCTTGCACATATTGACTTTGCTGCTTATAAAGGCATTAATGTTTTA
TAGTTTATAAATATCTTTCCACCAATTGTTACACCCAAACCATGATGGATTCCAATTCCA
TAGCTATACTGTTAGTAGAGATATAAAAGGTGTGCTGAATGTTTCATTTGTGATGTTATT
TGTCTCTGAACTTTACACTGTCTAATATCTGGTTAAATATTCATAAATTGTATTCTTATC
TGATCTAATTATAACTATCCTAATTCATATTTATATCCAACTCCTGATATGTAAAAATGA
TATAATATGGTAAGATCACCTTTGATCTTGTTTTCATCCCTACGGTTAGAACATAAGACA
ACTATTGAGTATATTTGTCTACGCATCGAACATGTGAATTGCGATTTGCTACTGCTGATA
AGGGGTATACCCACTTCAGCCGTCTGCATTGAAGATGGCATGAAAATTTCTTACATATCA
AAATATCCAAAATTTTATGGCATATTGGTATTAGTAACATGAGTACATAATGCTTTTGTA
CAATTTAAAATGAAACTTCAGGTCGGCAGATATACCCATTAAAAACATATTTTGTGAACC
CAGTATGACTAATAGATGGGAAGTTTTGATTTTTGATGCATATTTCATCCCTTCATTGTG
ATTTATATGGGAATGTGGGGGTGGGGGGTTGTTTTTTTATGGACTGTACCAGGAAAATAG
AAAAAACCTGGGCAGCTTTTGATTCTTCGGTAGTTTATGATCAGTTTTCAGTTCCCTGTC
CCATACAGTAATTGCAACGATCCACAGAATGAAAGTGAAATTAATTTGCCTCTTGTTGGG
TTATTGATAAACTGCACAGTACCTGTTATTATAGATGTACTCATCACAGCTTCTAGAACT
ATCTATGCTAGTTAGTTTGCTTTAGGTTACTCTTTTTACAAAGCTTATTCTGATATTTCT
ATTCAGGTGGTTGAAGAGGTGGTTCTACTCGATGGAGATACTTGCATTTCAGACTCTGCA
GAAAAAACATCCTCTGCATGTGATGCAATGAAGATACACTATCCTTCATGGGACACCCCT
AATTCTATTGAGCTTTCTTATTCTGACATGAAGTGTCTTGAGCCTGAATCATTGTTGTCC
TCACCTATACTGAACTTCTACATTATGTACCTAATGGGACAAATGCCATCGACAAGTAGG
CTTGGAGGTGGACAATGATGCTTATTTCTTGAATCTGAGAAGATGGTGGAAAGGTGTAGA
TATATTTAAAAAGGCATACATAATAATTCCTGTGCATGCAGACGCACACTGGAGCTTGGT
CATTATATGTATGCCTGCAAAGGAAGACCAATCAGGGCCCACCATATTTCATTTGGATTC
ACTGAAGTTTCATAGCAGCAGATTTATTTTCAGCACCGTTGAGAGATTCCTTAAAGAAGA
ATGGAACTACCTGAATAAAACTGGTTCTTTAGAAGATTGTCATCTACATGAATCAGTGTG
GAAGAACCTTCCTCGGAAAATTAAGAAGAAAGCAGTTACAGTTCCACAGCAGGACAATGA
ATACGATTGTGGTGTCTTTGTTCTGTACTATATGCGACGCTTTATCGAGGAAGCACCTGA
AAGGCTTAACAACAAGGACTCATCTAATATGTTTGGCGAAGGGTGGTTCCAACGTGAAGA
GGCTTCTGCACTGCGAAAGGAAATGCAAGCTCTGCTTCTTCGGTTGTTTGAGGAAGCTAA
AGACAACAACCACATGAGAGATCCAACAACACCAGTGTCAGCAACAGCGGAGCACCCTGT
TGAAGTCTTGTCAACCGAGCCAGCAGTACCAGACCACCCTCGGAATGCGGTTGGCGTCGC
CACCTCATAGTTTGCAGGCGGCTGCCATGGGAGCTGGCCTTGGAATGTGGAAGGTTGGTG
TGCATCCGGAAAACATAGCTCTCAATTGTCTTCTCCGGTTATGCCACAAGAGAAGGAAAC
TTGGAAGGTACTGTACTGGGTACTATGGTAGGTAGGTCTGCAAAGATGCGATACTGCCGT
GTATAGTTTAGGTAGAAAGCCGGGTTATCCGCTGGGCTCTTGGGGATAATTTTGGTTCTT
GGTTAGTTCTTAGGCTGGGCTACAAGAGAATGGTCGAATTTGACAAACTGCTCCTACAAG
CTCTGAGCTGCCAAGTTGACAGCTGCAGGATCTGCTTGTAAACCCATGAGGAAGGGGAGA
ATCATCAGAATAGCTCTCACCTGCCTGCCCAAATTTCTGCTTGTAAAGCATTCTGAATTG
AAGTTCTGATGGGTATAGCCGTCGGTGGAGTGGAGGCACAACTTTTGGAGTTGGATACTG
TCATCGCTCTTAAAACCATGCTTTTGGGGACACTTGTACATTTGGTGCTAGTAAAAGTCA
GGCGGCATCACGGAGTTC

CDS

585 bp

>Os06t0487900-02 Hypothetical conserved gene.
ATGGCcggcggcgaggacggggccgacggcgtcggagatgacaccgagcttcgcaggttc
tcagacgtggagctgctggagaagtcgcggcgcattcagggggagctcagtgggggtatc
gagcgaaggctcaaggaccgcggggccaagtttcgccgcttgctagacgccatcgtcCGC
GAGATTGATCGCCGTAAGGCAGCAACGGATGATGACAGATGCGCAAGGGTAGTTCAATCG
GGATGTGCAGAATCATCAGTTAAACAACAAGCAGTAACCATATCAGATTTTCGGTCCTCC
TTTGGGATAGATGAAGAGGCAGGCGTTGATGTATCTCATTTGGAAACAAGTGCATGCATT
GGCGACCCAAAAACTTCAACAGATAATGAGGGGATCTTGTGTGAAGAGGAAGATTCCTAT
GCTGCTGATGATGGCAAGGATAATGGCTACAGTAGGATATGCAAAGATGCCCACACTTCT
AGGAAAAGGAATGGAGAATTTTCACCTACCTTTTCAATGCGATTGCGATCAAGAAAGGTT
AGTATGTACATTTTCCTTTCCAAACATCGTGACATGGTATACTAG

Protein

195 aa

>Os06t0487900-02 Hypothetical conserved gene.
MAGGEDGADGVGDDTELRRFSDVELLEKSRRIQGELSGGIERRLKDRGAKFRRLLDAIVR
EIDRRKAATDDDRCARVVQSGCAESSVKQQAVTISDFRSSFGIDEEAGVDVSHLETSACI
GDPKTSTDNEGILCEEEDSYAADDGKDNGYSRICKDAHTSRKRNGEFSPTFSMRLRSRKV
SMYIFLSKHRDMVY*

5'UTR

chr06:16745551..16745608 (- strand) : 58 bp

CDS

chr06:16745344..16745550 (- strand) : 207 bp

chr06:16744778..16744829 (- strand) : 52 bp

chr06:16743866..16743924 (- strand) : 59 bp

chr06:16743698..16743797 (- strand) : 100 bp

chr06:16743559..16743628 (- strand) : 70 bp

chr06:16742678..16742774 (- strand) : 97 bp

3'UTR

chr06:16740421..16742677 (- strand) : 2257 bp

chr06:16739496..16739525 (- strand) : 30 bp

chr06:16739314..16739409 (- strand) : 96 bp

chr06:16738119..16738160 (- strand) : 42 bp

chr06:16736965..16737058 (- strand) : 94 bp

chr06:16736650..16736772 (- strand) : 123 bp

chr06:16736212..16736326 (- strand) : 115 bp

chr06:16733814..16733924 (- strand) : 111 bp

chr06:16732927..16733693 (- strand) : 767 bp

FASTA

>Os06t0487900-02 class=Sequence position=chr06:16732927..16745608 (- strand)
GTAGGGGGTA GAGTAGGGGA ATCCGCGCCG CCTCCTGCTC CTGGCCGCCG TGAATGCTAT GGCcggcggc gaggacgggg
ccgacggcgt cggagatgac accgagcttc gcaggttctc agacgtggag ctgctggaga agtcgcggcg cattcagggg
gagctcagtg ggggtatcga gcgaaggctc aaggaccgcg gggccaagtt tcgccgcttg ctagacgcca tcgtcCGCGA
GATTGATCGC CGTAAGGCAG CAACGGTGAG ATTCTTCTTC TCTTCTTTTT TTTTTATGCT GTAAGTTATT TTCTTGGTGT
GCGGTGAGGG GATTAAAGAT TCAATCCTTG CCCGGTGCGC TTCAATTAGG GCATGATTGA AGGGATGGGG AATCTTGATT
TTTGTTATGC TTCTGTTCGA TGATATGCCT GCCGCGCATA CCCAACTGTA ATAATCCAGT GTTGACAACT TCAATGTACT
GTAAGGCTCT TGTTATCTTT GGTGTGAGGA TGGTGATTAC TGGAGAAAAT GATATTATGT TATCAATGTA CTCCTATATT
CTAAGGGAAT GCTGGCCAAT GCTAATCACT TGATAAGTTG ATATTGTGAA TTTTCTTGTG TCTGATCTCT AAAATAGGTA
ACAAAAGAGC GCCTCACACA ATATATGAAG TAGATGTTAG GCAACCAATC CGTTAAATGC TACAGCTATT TACATATACA
TTAGTTATTA AGGGTGGATA AGGTCTTTGT AAGACTGATC ATCGTATGTT CTCTTGCAGG ATGATGACAG ATGCGCAAGG
GTAGTTCAAT CGGGATGTGC AGAATCATCA GGTATGGGAT TGATTTGTGT TAAGATATTG GTTGATTTAT GGTTGGTAGC
ATGGATCATT TATGACTGGG ACTTATAGTA CACGTGTTCT CGTTCATGAC TTCAAGTATT GATTTGCTTG CTGTTCTATT
GAACGCTTGT TACTCACTGC GGTGCCAGTG TTGTGTGATA GATGCTGTAA CTTACTGAAG ATAACTTAAT ATGTCCTTTG
CTTCTGTCCT CTCTTAAGAT ATGGGCAAGC TGTCTATTTC ATTCTTCATA CCTTAAACGC TTTGCTTTGT AGTAGATTTA
CATGCATGAA AATGCAGTAT AGGTTTTCTT AGTTCAAATG ATACATATAA TAAAATAATG TGGAAGAGTA ATACAATTTT
ACTACAGTTA GTTCCTGATT TGAGCTGTTG GTTCACATTT TTCTTCAATA TTTGATGATC TAAGGTGAGC CACTCCTATG
TCATGTGACT TCCCATTTGT TGAGTAAAAT GTTGATAAAA TCCAGAATTA GCTGATGCCC AAAGCTCTTT TCAAAGGAAT
TAATTAGTTT CAAAATTGTG TGATGCTCAG TAACAGGTCA CGATGAACAT GTATCTGTTA AAAGAAGAAA TCACCACTTT
CTAGTAATTT TACTCCAAGA GTATATTAGC ACACAATTCG AGATTATATG AGCAAGCTAC TGCTAGTCTG CTACTATATC
AATTGGGCAG ACAAAAACCT TGCTAGTTTT CAGATCATAT TTCTTTGTTT CATAATAGTT GGCCATTTTT TTACCATGTG
TTTCTTTTAT AGTGATATCT ACAATTGGTT ACTATTCTAT CTGAATTTTA TTCCATGCCA ACCTGTTGGT TTTATTAATG
TCAGTTAAAC AACAAGCAGT AACCATATCA GATTTTCGGT CCTCCTTTGG GATAGATGAA GAGGTAACTA TTTTGATCTT
TGTTATATAA ACCCAGTATT TTGTGCAAGT GTTTTATTTC CTTTACATTA GGCAGGCGTT GATGTATCTC ATTTGGAAAC
AAGTGCATGC ATTGGCGACC CAAAAACTTC AACAGATAAT GAGGGGATCT TGTGTGAAGA GGAAGATTCC TGTAAGTGTA
AACCCTCTAC GTCTCAAAAG GCATCATATG TTGATAGGTC AACTTATATG GAAAATATAG ATGCTGCTGA TGATGGCAAG
GATAATGGCT ACAGTAGGAT ATGCAAAGAT GCCCACACTT CTAGGAAAAG GTTAGTATAC ACAAACTCTT GTATTGCAGA
GTCTCAAGCC GAACATCCAT TTTCTTTGTT ATGGGAATGT TAACAGTTAA CTTGTTCTAA AATCATGCAT CATTTCATGA
GATGCATAAC CCTATCAAAA TTCTTGGTGT TCATACCTTA TAGATATTAA AGCATCAAGG GAAATGCAAA ACATTCGTTT
AGATAACTTA TTTTTTTACA ATTTAGAATT ATGAAGCATG GAGATGTAGG TTTCCATCAA ACACTGATTT TTTAATTGAA
TCAAACGCAT CCAAGACAAT GCAAAACATA GAAAAAAAAG AAGCAATCTT ACAGTTGCAA TGATTTATAT AAAAGTTGta
ctccctccat tttttaatat atgacgccgt tgactttttt tagatacgtt tgaccattta tcttattcaa aaaaatatgt
aattatcatt tattttaatg tgacttgatt tatcatcaaa tgttctttaa gcatgtcgtc agttttttta tatttgcaca
aaattatatt aaaaaaaCGG TGGTAGTACT TTTTATATGG TGCAAATTTA GGCTAAGCAT TGTGACTGTT AGATAAAGCA
AATCAGTTGA CAAACAAATA GCAATACTGC TATTATATAT ACCATGTCTT GTGCATCTGT TAGACTGTTA GATTGTTGTA
TATCTCACCA GTTCTAAACT TGTAACTGCA TATATGTATT GATCAATGAA TATGTTTTGT TAATCTGTAA CTTATTAGTT
ATTGTATTGA ATTATGTTAT CTGTCCTCTA CTAGGAATGG AGAATTTTCA CCTACCTTTT CAATGCGATT GCGATCAAGA
AAGGTTAGTA TGTACATTTT CCTTTCCAAA CATCGTGACA TGGTATACTA GTAGTAATTT TTATGTTGAA TACTAAAGTT
CTAGTAATAC AGTTGGCAGA GGTCCACCAC CCCTATTATT GCCAGTACAT AAATTAGTTG ATTTGTTTTT TGACTATCTG
TTATGGTGGT CAATAACATG GAAAGATTAA TTATATTTTC TAACTGGGAA AAAGGAAATA TTTATTTGCA ATGATATTAT
CATCTTCTCG CTCACTATCA AAGAATGAAC CTTACTGCCC TAAAGGCTCC TCCTTTTAAC TGAATTGTGA TAAATTTGTG
AAGTTCCGTT TGCTGATGTG TGGTTGATTC TGTTATTACC AAGCTTGATG ATAAATTGTT GATTAGATGA TTGTACACGC
TGTGTTTTAT CTTCGTGTCA AGTGAATTGT TATTTTTCAT GCATGCTCAT TGAGTTTTTT ATACTTTGAC CATTTTCGCA
TTCCTTCATT TCACAAATAC ATGCCATTTC AGATGTTACC ATAGTTTCTA ATCTACAGCT TTGTGTACTA ATTTCAGTAG
TAATATGCTG GTAAAAACTA TAAGATATGT TACTACAAAA TGTATTCCTT TTGAGAATCT ATTAATATTA TTTCCATATA
AACTGATTAG ATACCTTTTT TTGTTATAAC ATTGGTGCTG ATTTCTAGTA TGCAACTATG CATTACTAAA ATTGGAATTT
ATTTGTAATA TGTGACATTT AGAAGGAAAG ACATAGAAAA CCGGTTATTT TCTAAGTAAC TACGATTAGA ATAAGGATTC
TGCTCCAATT AGAATCAAGA TGGACCCTGT ACAACATGGT TCTATGGTAA CAATAGAGTC CTAGGATTGT ACTATTAAAA
GCCTTTTTTT GAACCTTGTG GCAACAAGGG GTTCGGGGGA TTATGTAAAC AAAAAGGCAG GAGGGGTGgt cgaacagaga
cgaaagtcgg ccatagtgat ccgggagtcc cgtgtggaag ggctctcgct caacggatca aaggtacgcc ggggataaca
ggctgatgac tcccaagagc tcttatcgac ggagttgttt ggcacctcga tgtcgactca tcacatcctg gggttgaaga
aggtcccaag ggttcggtct cttagttgag gagtggtGGC ATGGGATCTC TAATTCTCCC CCATGTTCAT GCATATGGGG
CATTTTGAGT TTGTTCTGTG GTGTGAACGT TTTTTTGCTC TTATTTTTCT TAACAAACAA CAAAATTTTC TGGGTTTTTA
AATCTTGCAC ATATTGACTT TGCTGCTTAT AAAGGCATTA ATGTTTTATA GTTTATAAAT ATCTTTCCAC CAATTGTTAC
ACCCAAACCA TGATGGATTC CAATTCCATA GCTATACTGT TAGTAGAGAT ATAAAAGGTG TGCTGAATGT TTCATTTGTG
ATGTTATTTG TCTCTGAACT TTACACTGTC TAATATCTGG TTAAATATTC ATAAATTGTA TTCTTATCTG ATCTAATTAT
AACTATCCTA ATTCATATTT ATATCCAACT CCTGATATGT AAAAATGATA TAATATGGTA AGATCACCTT TGATCTTGTT
TTCATCCCTA CGGTTAGAAC ATAAGACAAC TATTGAGTAT ATTTGTCTAC GCATCGAACA TGTGAATTGC GATTTGCTAC
TGCTGATAAG GGGTATACCC ACTTCAGCCG TCTGCATTGA AGATGGCATG AAAATTTCTT ACATATCAAA ATATCCAAAA
TTTTATGGCA TATTGGTATT AGTAACATGA GTACATAATG CTTTTGTACA ATTTAAAATG AAACTTCAGG TCGGCAGATA
TACCCATTAA AAACATATTT TGTGAACCCA GTATGACTAA TAGATGGGAA GTTTTGATTT TTGATGCATA TTTCATCCCT
TCATTGTGAT TTATATGGGA ATGTGGGGGT GGGGGGTTGT TTTTTTATGG ACTGTACCAG GAAAATAGAA AAAACCTGGG
CAGCTTTTGA TTCTTCGGTA GTTTATGATC AGTTTTCAGT TCCCTGTCCC ATACAGTAAT TGCAACGATC CACAGAATGA
AAGTGAAATT AATTTGCCTC TTGTTGGGTT ATTGATAAAC TGCACAGTAC CTGTTATTAT AGATGTACTC ATCACAGCTT
CTAGAACTAT CTATGCTAGT TAGTTTGCTT TAGGTTACTC TTTTTACAAA GCTTATTCTG ATATTTCTAT TCAGGTGGTT
GAAGAGGTGG TTCTACTCGA TGGAGATACT TGCATTTCAG ACTCTGCAGA AAAAACATCC TCTGCATGGT AAATGAGTTT
ATGATTTGTC ATTTGGCCAC TTGTGTTCTT CCATATGTGT ATACCATCTT AACCTATGTC GTTGGTCGGT GTCTAAGTGA
GTTTGTGCAC AAACTTGTGT GGTGGTTGCA AATAGGTATA ACAACCTGCA AATCGTTTGC TCTGGTGCAA CAACTTGCTT
AGTCTGTGCA AACCTGGGAC AAAAGTCCAC GCAAGCGGAA ACTAATCTGA GGTGGCCCTC ATTGATGATA CATATAGGCC
TGCAGTACAC ACATAAGTTC CAGGCTAGAC TAAAGCTACT TAATTCAGAT ATTGAACCAC TTGCTTGTGT TCTGCACTAT
AGCAAACTGA ATTAGAGCAA GCAGGAAAAC AAAATCCCTT GGATGCTATT GTGTTCTGAC ATTGAACCAG TATCAAAGCT
ATTTGCTTGA TTTTAATTCT TCAGTATTTG AAGTTTTGAA CCACCGTAAA TAACTGCTAA AACAATGTAT AGAGGCCGTC
ACAGTAATCT AATCCTTCTA CTACATTGTT GCACAAAGCT ACTGCAATTC TGCTCCTTGC CCATCAACAT CTTATAAGCA
ACAACATAAA AGTTCTCCCA TATTCATTAC ACAACGGTTA ACTATTGGTG AGCCTTGGTC GAGATATGTC CGTACTACAG
GCCTACACGT CATCAATGAG TGCCACATCA AATCATTTTT GCTTCTGTGG Attgttttgt cctgggtttg cacgggctag
gcaagttgtt gcactgaagt gaacaatttg caagttgctg tacctactta cacccactgt gcaagtttgt gtaccgaaag
tgcaatttac tTATTATATT TTACGTCTAG TATTTTTTCT GTGATTTTTT CACTACTGTT GACTAATGCT GGCACTTCTA
CAGTGATGCA ATGAAGATAC ACTATCCTTC ATGGTTGGTC TTTGAACTAA CATAATTATT TGAGCTTACT CTGTTTTATA
TACAGTTGAT GGTTAATTTT GTTTTTCTGT TCTCTGCAGG GACACCCCTA ATTCTATTGA GCTTTCTTAT TCTGACATGA
AGTGTCTTGA GCCTGAATCA TTGTTGTCCT CACCTATACT GAACTTCTAC ATTATGTAAG TGTTTGTGGA GAAGGATGTG
CATCATAGAC TCATAGTTTC ATGAAACAAG GGCATTGTTT TAGGAGAAAA ATATGTATTC ATCACGGAAA ACAATTAATA
ATAAAGATCA CTTCATTAAC ATAGACCATA AAAAGATCCA TGGCTCATTC TAGCAGCCTA TTTTCACATT TTTCATGTTG
ATATGTAAAA CATGGTGATC AAGGTGATAT CTGGGTGTCA TTTAGGCAAT AGTTAGGCAC TGAGATTGTC CGGTGTGGTC
AAGATGACTG ACTGGCTGTC TCCTAAAACA TTGAGCAACA AATTAAAATG GAAGGGAGGC AGATTGAGAG CCTGCTGCCG
TGTTGCCACA ACTGCTGTTT TTGTTCACCA TTGTCGTTGC TGTATTCATG CAACAGCTGG GTCAGGTTGA TTTCTCAAGT
TGTATTTCCC TTTTTACTTC TTTTGCATTT TCCCTATAAA TCCTGCTGCA TGCTAGTTTT ATGGCATCAT CTAGGCTTTC
AGACAGTCTT TCTCTAACAC CTTACACCTt ttcttctcta tcttaatgaa atgatacaca gatcttctgc atgttctaaa
aaaaaatcta ggctttCAGA CAGTGCGTCA TTGCCTCTTG TCACGTTGTC ATTGCCTCTT GATGGTTCAT GTTCTGTTCA
CATCATGCAT GCTATATATT TGAGATGGAG TGACACACCA GTGTAGAGCT ACTGTTGTAT GCCCCCCACT TTATCCTGGC
TTTACACCTT CAACTAATTA ATCAATAAGC ATTTGAACAT TATCCATTCA ATGATTTGAA CAGACACAAT GAAGCAAACA
AAAAATATGA AACTCCTGTT GTAGATGCCA ACATAAATTT CTCATTTAAA CAAGAAATAA GTGATCTTGT CCTTTAGGCT
TGAATTGCCT TTAATGGACA TTGGAGCTCG ATAGCAATCC ATAGACCACG TTTCAGATGT TAGCATTTGT TTTGCGTGCT
CTATTGCCTT TGTGTAATGG TGATGCAAAA TATATCTCAG CAACATCTTT TGGTATCTGT TGGTGTTATT AACACTTGAT
TATTTATACT TTTGTTGTCT TGCATGTGTT AAAAATGAAC TTCTGTCTCT TTTTTTATTA ACAAAATCAT AAAATGAAAT
CCATCTAGGT ACCTAATGGG ACAAATGCCA TCGACAAGTA GGCTTGGAGG CAAGTATCAT ATTTTCAATA CATACTTCTT
CAGCAAACTT GAAGCCTTGA CATCAAAGGT TTTTTCCTAT ATTAGATTCT TAACATTTAC TTTATTTCTT AAAAAAATAA
TATGCTATAA TGTGATTGAT AGATTTGCTA TCTTTTCTTG TTCCTTTTCT ATTTTTTTTT GCGGGGTATT CTAGTTCATC
TTTCATATTA GATCTTGAAT TTTGCACCTA GAAAGATGAA TAGCTATAAT TCAACATGGA CAAGAGAAAC GAGTACAAGA
CTAACCATAT ATGTATATGT TCTATTCAAT CTTACTGGTG TTTTAGGTAT TTAGTTCGTA ATTGTTGTTA TGGAGTTCAT
GCCTTGTGGA CAGCAGTTAT GTAGACAAAG CAGCAGTGGT AGCACTTGTA ATTTTGGTTG CAGCTAGCTT GTCAATTCAT
AAGGTACAAC TGGCTAGGAT TCAGATAATT CACTAAGAGT AGCTAGTTTG GCATAAGTCG TTATGCATAA GGTTGTCTAG
TTCCCAATCA ATTGTTGCCT CTTAGATTTG GTTTGGAGTT GGTAGACCAT CTGTATGAGG GAGCTAGTTT AGCTTCTCTA
AGTTACGTAA GAGATAAACT CTTGACTAAT GTCCACTTAG CTGGTTTATC AGTCGTATCA CAAAGGATTG AATCTCCTAC
AAGCTAGAGG GTAACTACGC CTCCATCTAA CCAATTTTTA GCCCTCAGTC CCAAGCCATA AACACCTTTT TCTTTGTCCT
AATGTAGCAA CTGCTGGCTA CATGTATCAT GCATAAATTA TGTTTAATTT CATGCTACTG TTAGCTAAta ctctctccgt
cccaaaataa ctccactttt ctacacgaat ctagacatag cctatatcca gattcttgta taaaagtgaa cctattctgg
gacggaggta gtaCCTATTT TTTTTATTAC TTTTTCATAA ATGAAAAATT GATGTTAGTT CACCATTTTG ATTTTTTTAT
AAAAAAATCC ATGTGATGTT TATTTTGTAT GGTTATTCCT TTAATTTTTT TTGTATTCAT ACTCTGAAGG TGGACAATGA
TGCTTATTTC TTGAATCTGA GAAGATGGTG GAAAGGTGTA GATATATTTA AAAAGGCATA CATAATAATT CCTGTGCATG
CAGAGTAAGC AATTTTGTTG CCTTCTTTTT GTTGTCATCA GGAATACAAC AATTATTTGT TACCAACTCA TGAGCTCAGG
TCCCAAGTCC CAACTCCTGA GTTGGGACCT GAGCTGATCA CATGCATATC TTAACCTATC TATGCAACGC TACCTATTCG
GCTATTCCTT ACAGTATATT GTATTGTATT GGTCAGCGCA CACTGGAGCT TGGTCATTAT ATGTATGCCT GCAAAGGAAG
ACCAATCAGG GCCCACCATA TTTCATTTGG ATTCACTGAA GTTTCATAGC AGCAGATTTA TTTTCAGCAC CGTTGAGAGG
CAAGTGGTCC AAAAAACTTC TGAGAATTTG TATGTTGTGT GTTATTTGGT GTACCACCTT TTTTCTCTTA AGTACACAAA
TACATGTGAT AAAGGCCAAC ATTTTTTCAA CATGTTCTTT TTTCTTTTTT CATAATTGAG TTCCCCAACT TCCCAATAAC
TGCACTTCTG CAATTGGTAG AAGCTTAGCT TCTGGTATCT GTATACTGTT ATTTGGTGCA TGCCTTTTTA TTCCTCCTGC
TTATATGGGT ATGAAATTGT TTGATACTCA GTTTAAGCTA GATTATTTTT AGTGCTTTCT TACACCTTGA AGTTGTTTAC
AGATTCCTTA AAGAAGAATG GAACTACCTG AATAAAACTG GTTCTTTAGA AGATTGTCAT CTACATGAAT CAGTGTGGAA
GAACCTTCCT CGGAAAATTA AGAAGAAAGC AGTTACAGTA AGTGTTTCCT CCCTCCAAAT GCAATTGCAA ATGTGTGCAG
CTTCTTATCT TTTAAAAGAT AACGTATACT ACCTATATAG TTGAAATTTC CAATAGTCTA CTTCTCCATT ATTTAGCCAT
GCATGTATCT TGCATCAGAC CCATGTTTGT ATTATTTACT GTGATGTTAC TGAAAACTGT TAAATTTAAG ATCTCCTACA
TCAAGATTTT TTTTATTTTA TTAGCAATGT AAGGATAAAT ATTTTGGTAT AAGGTACTGC TAAGACGATC ATTTGCAACT
TTCCATGACA ATTTGTCCTT TCTACTCTAA GTGAGCAATT TCTTCGAGAC TGAAGGTGTT AAGTTCAACC AATTCAAAAT
GTACAGGCCG TAAACTGTCA AAGACTCAAA GTTTGACAAT GTAGGGGCAT GGCGACAATG GGTGTCTATC ATGTTTAGGT
TGTGAGCGAA CTACATATAA CCCACATGCC CCTTAGGTTG AGCGAACTAC ATATAAGCAG GGTTGGTGGG ATTGCATGCT
TTTTCTAATG TGCGAATAGA CTGCATCCAA TCTGGAGCAG TCTTACAGTT GTACAGTACA GGTAGGCAAT GACTAGGATA
TTTGGGACAT ACATTACCAA CAATAAATTA GGGTTACATT TGTAGAAACG GAAGTACTGT TTTCTTATAA AAATTAGAAA
ATCCATAATA TTCTGCTGAC CAATTCTACA TCATGCCATT GATGAAGTAC AACTCTATCA CTACCTCCTA TCCCTAAGTG
TAAGGGATTC TAGTCATAAA TCTGGACATG AAAATGCCCA GATTCATAGC CAGACTGCCA GAATCCATTA TAGTTAGAAA
CGGATGGAGT ATATGCCATT CGTTGACTTC CTTTGTTTCT TATGTCATCA CTGTTAGTCA AATTCTGGTA AAACTCCATC
AAGTCAAGTA GTGAACCTAT TGTTCTCAGA GACTGAAATA CCCTCATTTT CTTTATGGGT GAAAGGCAGA GCAGAGTATT
GTACACTAGA ATTTTAAAAA GGTTAGattg gttccatgcc atcgaaagtt ctcgactttt ggtttatacc atcaaaagat
ctcggtgcac tttaatacca ttcaaagttt ccccgttacc ttttcatatc acaaccgttc acttctGTTA GAGCTTTATT
ATTTTATTTT TGTTCTCTTC CACATTTTGC TGAAAGGCAA AGGGGATATG TCTATACTAC CCTTCCTTTA CCCATCTAAT
CCTGCCCAAT CTCTTGTTCT TTCTCTCGAG CCAATCTGAA CGCATCGCTT GAGCATTGTG AGACACGGCT TCCCTGTTCA
TCTCGCATTC GCATGCTCCA CGCTACCATC GATGCGCATA AGGAGGCAAT TAGTCAAGCT AGCATATTCG GCATGCATAA
GGAGGCAGCA GCCATGGTTA GCAACCTTAA CCAACAACAA GATATTCCAA CCGCTCCTGG AGAGCCAGAG CCATGTGGTT
GCATTCGTAG ATAAAGCAAA AATTGCAGTG ACAGAATGTG GTGGCTATCT CCAGAGCGCC CGACACTGCT CGTCGTGTGC
GGCGGCCACC GTCGTCCATC GAGCGCAGCG CCGTGCCGCT CCTGGTCGGA GGAGCATGCC GAGTGAGCTG CACACGCGGG
TGGAATAGGG GCACGGAAGC AACAGGACCG GTCATCTGAC ACCAGCTACG ACCGGGGTTG GCTGCGGGAC AATGCGACGG
GGGCGGCAGC TATGCTGGAC GAAGGGGAAA TATCTGCTTT CGATCTGATA TGATGCATCG GGGCTATGAA CATGACACAA
GGGCAAAGAT GTCCTGCTTA ACGGGAGATT CAGCAAAGTG gacggaagtg gtataacgag taacgtggta aactttggat
ggtattaaag tgcaacgaga actttcgatg gtataaacca aaagtggaga actttcgatg gcatggaacc aattttgcct
TTTAAAAACG AAAGAGAACC AAGTAGGTAG TAACATCAAA ATTACTTTTG TGATAATAGT ATAGTGCACA TCAGCACATG
GTATCCTAGA GGCAAAATTG TCATTTTATT CTATCTATAG GTGGTTGATT AATGATGATG ATATATACAA AGGAAACTAT
TGGACTTTgt cagtggcaaa tcatagaact ggtgcttcat caatggcata tgatggaatt tctccattag tattgTTCAG
AACATCTTGA TTCTGGCTGG TTTGTTTGTT CTTGGTATTT TGTTCCTTTA ATTATCCTTG CATTCTTCTT CCTTTTGTTG
CCAGGTTCCA CAGCAGGACA ATGAATACGA TTGTGGTGTC TTTGTTCTGT ACTATATGCG ACGCTTTATC GAGGAAGCAC
CTGAAAGGCT TAACAACAAG GACTCATCTA ATATGGTGAG TCACCATTAG TTGAGTTTTC ACCATTTTAT ATGATGGTGT
TCTACTGCCT GCACGGATAC TTATAGCTGC CCTTATCTCT CTTTTCTTTT TTATTTTTCT ATTTTCCCTT GTTAGTTTGG
CGAAGGGTGG TTCCAACGTG AAGAGGCTTC TGCACTGCGA AAGGAAATGC AAGCTCTGCT TCTTCGGTTG TTTGAGGAAG
CTAAAGACAA CAACCACATG AGAGATCCAA CAACACCAGT GTCAGCAACA GCGGAGCACC CTGTTGAAGT CTTGTCAACC
GAGCCAGCAG TACCAGACCA CCCTCGGAAT GCGGTTGGCG TCGCCACCTC ATAGTTTGCA GGCGGCTGCC ATGGGAGCTG
GCCTTGGAAT GTGGAAGGTT GGTGTGCATC CGGAAAACAT AGCTCTCAAT TGTCTTCTCC GGTTATGCCA CAAGAGAAGG
AAACTTGGAA GGTACTGTAC TGGGTACTAT GGTAGGTAGG TCTGCAAAGA TGCGATACTG CCGTGTATAG TTTAGGTAGA
AAGCCGGGTT ATCCGCTGGG CTCTTGGGGA TAATTTTGGT TCTTGGTTAG TTCTTAGGCT GGGCTACAAG AGAATGGTCG
AATTTGACAA ACTGCTCCTA CAAGCTCTGA GCTGCCAAGT TGACAGCTGC AGGATCTGCT TGTAAACCCA TGAGGAAGGG
GAGAATCATC AGAATAGCTC TCACCTGCCT GCCCAAATTT CTGCTTGTAA AGCATTCTGA ATTGAAGTTC TGATGGGTAT
AGCCGTCGGT GGAGTGGAGG CACAACTTTT GGAGTTGGAT ACTGTCATCG CTCTTAAAAC CATGCTTTTG GGGACACTTG
TACATTTGGT GCTAGTAAAA GTCAGGCGGC ATCACGGAGT TC