Os06t0496400-01

Locus

Os06g0496400

Description

ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development

RAP-DB Gene Symbol Synonym(s)

OsbHLH127, OsRSL3

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 127

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH127, bHLH127, OsRSL3, RSL3

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 127, ROOT HAIR DEFECTIVE-SIX LIKE 3

Transcript Evidence

XM_015787181.1.

Protein Evidence

Q651K2

Literature

PMID: 27494519

PMID: 27716929

Note

Manual Curation

October 4, 2016

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Expression Databases

TENOR (Os06t0496400-00)

Others

Oryzabase (15405)

Transcript

1276 bp

>Os06t0496400-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
GCGCTCTTGTTTAATCGTCGTCTTCCCCATTGGCCATGTGGGTGTCCCTCTCCATGGAAT
CCATGGCGCAGCTCAGCTCCCATATAATCCATGGCGCACACTGTCTTGCCAGTTGCCACA
TTAATTCAGCATCCCTCTGCTTAATTGCTTCGTAGCATACCAAGTAGTAGTGGTAGCAGC
AGCAGCAGCAGCAAGTAGCACCTGTGCTTACTCGCCATGGCTATGGTGGCcggcgacgag
gcgatgtcagtgccatggcacgacgtcggcgtcgtcgtcgaccccgaggcggccgggacg
gcGCCGTTCGACGCCGGCGCCGGCTATGTCCCATCGTACGGTCAGTGCCAATACTACTAC
TACTACGACGACCACCACCACCACCCGTGCAGCACGGAGCTGATCCACGCGGGCGACGCT
GGCAGTGCGGTTGCGGTTGCGTACGACGGCGTCGACGGCTGGGTTCACGCCGCCGCCGCA
GCCACCTCCCCGTCCTCGTCATCTGCGCTCACCTTCGATGGTCACGGCGCCGAGGAGCAC
AGCGCAGTGTCGTGGATGGACATGGACATGGAcgcgcacggcgccgcgcctcccctaatc
ggctacggcccgacggcggcgacctcctccccctcctcctgcttcagctccggcggctcc
ggcGACAGCGGCATGGTGATGGTGACCACCACCACCCCGAGGAGCGCCGCCGCCTCTGGT
TCGCAGAGGCGGGCACGCCCGCCGCCGTCGCCGTTGCAGGGATCAGAGCTGCACGAGTAC
TCCAAGAAGCAGCGCGCCAACAACAAGGAGACACAGAGCTCAGCTGCCAAGAGCCGGCGG
GAGAGGATCAGCGAGCGGCTGAGGGCGCTGCAGGAGCTGGTGCCGAGCGGCGGGAAGGTG
GACATGGTGACCATGCTGGACAGGGCCATCAGCTACGTCAAGTTCATGCAGATGCAGCTC
AGGGTGCTGGAGACCGACGCGTTCTGGCCGGCGTCCGACGGCGCCACGCCGGACATCTCC
CGGGTCAAGGACGCGCTCGACGCCATCATCCTCTCCTCGTCCTCGCCCTCGCAAAAGGCT
TCTCCTCCTCGGTCGGGCTAGCAAATATATCGACGAGCTTCCGATCTCCCAAAATCCAAA
TTACGCTTACTTGCAACTCCGGATGTTGCATTCATTTTGTTCGTCATGCATGTATAATTT
CCCGGCTTTGCTATGTAATTAACTACTGTATTACGTCGTGCTAATTAGCTAATGATACAT
GCTATTTTGCGTTGCT

CDS

885 bp

>Os06t0496400-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
ATGGCTATGGTGGCcggcgacgaggcgatgtcagtgccatggcacgacgtcggcgtcgtc
gtcgaccccgaggcggccgggacggcGCCGTTCGACGCCGGCGCCGGCTATGTCCCATCG
TACGGTCAGTGCCAATACTACTACTACTACGACGACCACCACCACCACCCGTGCAGCACG
GAGCTGATCCACGCGGGCGACGCTGGCAGTGCGGTTGCGGTTGCGTACGACGGCGTCGAC
GGCTGGGTTCACGCCGCCGCCGCAGCCACCTCCCCGTCCTCGTCATCTGCGCTCACCTTC
GATGGTCACGGCGCCGAGGAGCACAGCGCAGTGTCGTGGATGGACATGGACATGGAcgcg
cacggcgccgcgcctcccctaatcggctacggcccgacggcggcgacctcctccccctcc
tcctgcttcagctccggcggctccggcGACAGCGGCATGGTGATGGTGACCACCACCACC
CCGAGGAGCGCCGCCGCCTCTGGTTCGCAGAGGCGGGCACGCCCGCCGCCGTCGCCGTTG
CAGGGATCAGAGCTGCACGAGTACTCCAAGAAGCAGCGCGCCAACAACAAGGAGACACAG
AGCTCAGCTGCCAAGAGCCGGCGGGAGAGGATCAGCGAGCGGCTGAGGGCGCTGCAGGAG
CTGGTGCCGAGCGGCGGGAAGGTGGACATGGTGACCATGCTGGACAGGGCCATCAGCTAC
GTCAAGTTCATGCAGATGCAGCTCAGGGTGCTGGAGACCGACGCGTTCTGGCCGGCGTCC
GACGGCGCCACGCCGGACATCTCCCGGGTCAAGGACGCGCTCGACGCCATCATCCTCTCC
TCGTCCTCGCCCTCGCAAAAGGCTTCTCCTCCTCGGTCGGGCTAG

Protein

295 aa

>Os06t0496400-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
MAMVAGDEAMSVPWHDVGVVVDPEAAGTAPFDAGAGYVPSYGQCQYYYYYDDHHHHPCST
ELIHAGDAGSAVAVAYDGVDGWVHAAAAATSPSSSSALTFDGHGAEEHSAVSWMDMDMDA
HGAAPPLIGYGPTAATSSPSSCFSSGGSGDSGMVMVTTTTPRSAAASGSQRRARPPPSPL
QGSELHEYSKKQRANNKETQSSAAKSRRERISERLRALQELVPSGGKVDMVTMLDRAISY
VKFMQMQLRVLETDAFWPASDGATPDISRVKDALDAIILSSSSPSQKASPPRSG*

5'UTR

chr06:17348908..17349123 (+ strand) : 216 bp

CDS

chr06:17349124..17349738 (+ strand) : 615 bp

chr06:17349884..17350153 (+ strand) : 270 bp

3'UTR

chr06:17350154..17350328 (+ strand) : 175 bp

FASTA

>Os06t0496400-01 class=Sequence position=chr06:17348908..17350328 (+ strand)
GCGCTCTTGT TTAATCGTCG TCTTCCCCAT TGGCCATGTG GGTGTCCCTC TCCATGGAAT CCATGGCGCA GCTCAGCTCC
CATATAATCC ATGGCGCACA CTGTCTTGCC AGTTGCCACA TTAATTCAGC ATCCCTCTGC TTAATTGCTT CGTAGCATAC
CAAGTAGTAG TGGTAGCAGC AGCAGCAGCA GCAAGTAGCA CCTGTGCTTA CTCGCCATGG CTATGGTGGC cggcgacgag
gcgatgtcag tgccatggca cgacgtcggc gtcgtcgtcg accccgaggc ggccgggacg gcGCCGTTCG ACGCCGGCGC
CGGCTATGTC CCATCGTACG GTCAGTGCCA ATACTACTAC TACTACGACG ACCACCACCA CCACCCGTGC AGCACGGAGC
TGATCCACGC GGGCGACGCT GGCAGTGCGG TTGCGGTTGC GTACGACGGC GTCGACGGCT GGGTTCACGC CGCCGCCGCA
GCCACCTCCC CGTCCTCGTC ATCTGCGCTC ACCTTCGATG GTCACGGCGC CGAGGAGCAC AGCGCAGTGT CGTGGATGGA
CATGGACATG GAcgcgcacg gcgccgcgcc tcccctaatc ggctacggcc cgacggcggc gacctcctcc ccctcctcct
gcttcagctc cggcggctcc ggcGACAGCG GCATGGTGAT GGTGACCACC ACCACCCCGA GGAGCGCCGC CGCCTCTGGT
TCGCAGAGGC GGGCACGCCC GCCGCCGTCG CCGTTGCAGG GATCAGAGCT GCACGAGTAC TCCAAGAAGC AGCGCGCCAA
CAACAAGGAG ACACAGAGCT CAGCTGCCAA GGTACTACAT TACATTGCAT CCATGTCGAC GATCTATATA TGAACCTAAT
CTTGCAGTGT TCATCAGTTG GATCGAGATG CAAGTTCTCC GACGAATTGA ATTGAACTGA ACGCATGGTT GTGTTTGTTT
GTTTTGACAT ATGCAGAGCC GGCGGGAGAG GATCAGCGAG CGGCTGAGGG CGCTGCAGGA GCTGGTGCCG AGCGGCGGGA
AGGTGGACAT GGTGACCATG CTGGACAGGG CCATCAGCTA CGTCAAGTTC ATGCAGATGC AGCTCAGGGT GCTGGAGACC
GACGCGTTCT GGCCGGCGTC CGACGGCGCC ACGCCGGACA TCTCCCGGGT CAAGGACGCG CTCGACGCCA TCATCCTCTC
CTCGTCCTCG CCCTCGCAAA AGGCTTCTCC TCCTCGGTCG GGCTAGCAAA TATATCGACG AGCTTCCGAT CTCCCAAAAT
CCAAATTACG CTTACTTGCA ACTCCGGATG TTGCATTCAT TTTGTTCGTC ATGCATGTAT AATTTCCCGG CTTTGCTATG
TAATTAACTA CTGTATTACG TCGTGCTAAT TAGCTAATGA TACATGCTAT TTTGCGTTGC T

Locus: Os06g0496400

Loading...

Locus: Os06g0496400

Loading...