Os06t0506600-01

Locus

Os06g0506600

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC17

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 17

Oryzabase Gene Symbol Synonym(s)

OsUBC17

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 17

Transcript Evidence

AK066232 (DDBJ, Best hit)

Protein Evidence

A3BC59 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J013057M05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0506600-01)

Others

Oryzabase (19561)

Transcript

2140 bp

>Os06t0506600-01 Similar to Ubiquitin carrier protein.
CTCCCCACCTCGCGTTCCCTCCCCTCTCCCCTCCGGCCATGGCGTCCAAGCGGATCCTCA
AGGAGCTCAAGGACCTGCAGAAGGATCCCCCAACCTCCTGCAGCGCTGGTAGGTATCCTC
CTCTTCTTCTTCTTCGCTGTCCCCCAATTCCAGGGTTCACGGGCGATTTTGTTTCTTGTC
GATTCATCGACTTCTTAGCGTGCCGGCTGCTGGATAGTGGAATCCTCTGTTGACTCTTTA
GCTTTCGAAAAAATTTTGAACCAAGGGAAGGGGAGGAGGGGGAGGTCATACTGTGCAGTG
CTGCAATTTTGTGTTTGTTTATGGTTTTGCTACCAATTTCGTGCATATTATTATCCCCTG
AGCGGGTGTGGAGCTGCGTTTTGTTATAATTCTGGAGCTGTTAATTGTTCTTCTTTCGCA
AATTTAACGCTTATTACGGCTGGCTGGATAGAAGGATAGAGAGCTCAAGCAGAGACGCTG
GATAGAGGGATATACGGTTTTAGAGGTTATTGTTCGTTCAACCTGCTTAGTTAGGAGTAT
ACCTTCGTTGTTTTAGTAATTTGTGGAAGCATGGGGTAGCATATCTAGGACATGGATAAG
TCTCGTTGGCAATGATACCAGGCCACAATCGTTGTTTACAACTCAACAATTTGTGTAACT
GGAACTAATTCTTGTGTACCGATGAAATAATAATACCCTCAATATGTGTGTGATGATAAT
TGTTCTTGTCTACATGCTAGTGTACCCCAAACAAGACATGTGGATGTTGTAGAATTGTTT
TGATATTTCTAACTGAATGTGACAACTTGTGTGGCGAATATTGGTTTCATGATATGTTCT
GTTCAAATGCATTGCAACAATTGAGATTGGATTGGAGTACCTTTGTATGACTAACACGCG
AAATACGCCTAACAGGCCCTGTGGGAGAAGATATGTTCCACTGGCAAGCTACGATTATGG
GTCCAGCAGATAGTCCATATGCAGGTGGCGTCTTCTTGGTTTCTATTCACTTCCCTCCAG
ACTATCCGTTCAAACCGCCCAAGGTATACATTCCTTCCACTTCTTTTTGTGTTGTTCAGG
AAACTGTTTGTTTTTAGGACTTGTGGAAGTTTATTATAAGAGCATCACTTGCTTCAATTT
TATATAATCTTAAGGCCCTTGAGTAACTGATTACAAGATATTTGCTGTTAGGGCTCTGCT
CTAAGCATTCATAGCTAGGGATAAAATGTCCTGTTAATTTCAGTCTCAAAGTGGAGTTCT
AACTGATCCTTTACAAAGCATAATATACCTGTAAATGTTAGTTTTGTAAAGGTCCTGATT
CACTTTGGCAAATGTGCGTTACCAATTCAACAAACTATGAAAATGCTTGTTTCTTCCACC
ACCATAAAAAAAAATGCTTCACTTGAGTTCAACGGTCACTGTAGCTTTGTTCTGATAACA
ATCATTTTTCAGGTTGCATTTAAGACAAAGGTTTTCCACCCAAACATCAACAGTAACGGA
AGCATCTGCCTTGATATCCTGAAGGAACAGTGGAGCCCTGCATTGACAGTGTCAAAGGTG
AATTGATCCTCTCCCTCTCCAACTAAGTCAAGAAACCCTTTGAGACAGCTTGTGCATGTG
CAAAAGCTTAGCTTCTTTGAAGTTGTCACATAGAAACTACTTACTTGAGAAGTTAGGCAC
TTTGGCACCATAGAAATGTTAGGAAGTTGGAGCTCTCATAGTCTCTAGGGCTTAACAAAT
GCCCAACACCGTATATCACCTGCGTGCTAATCTGGTTGGAGTAACTTTTGTTTTCCAGTT
GCACGAATTATCTAACGTTTGACACAATTTTCAGGTACTCCTCTCAATTTGTTCTCTACT
GACGGACCCAAACCCAGACGACCCGCTAGTTCCGGAGATTGCGCACATGTACAAGACTGA
TCGGGCCAAATATGAATCAACTGCGAGGGGCTGGACCCAGAAATATGCAATGGGCTGAAC
GACGTAGGCCGATAGTGTTCTCTAGCGATATATGTTATCTTGTTGATCTAGTGTTCATGT
CCTGCTACATGCCTACATGGGGTGTAATTTCTTCTGTCACTGAATTTATGTCAAATTCTC
GATTGATGGTAGAAGTTATTGAGAAAAATTTCAATTACCT

CDS

210 bp

>Os06t0506600-01 Similar to Ubiquitin carrier protein.
ATGAAAATGCTTGTTTCTTCCACCACCATAAAAAAAAATGCTTCACTTGAGTTCAACGGT
CACTGTAGCTTTGTTCTGATAACAATCATTTTTCAGGTTGCATTTAAGACAAAGGTTTTC
CACCCAAACATCAACAGTAACGGAAGCATCTGCCTTGATATCCTGAAGGAACAGTGGAGC
CCTGCATTGACAGTGTCAAAGGTGAATTGA

Protein

70 aa

>Os06t0506600-01 Similar to Ubiquitin carrier protein.
MKMLVSSTTIKKNASLEFNGHCSFVLITIIFQVAFKTKVFHPNINSNGSICLDILKEQWS
PALTVSKVN*

5'UTR

chr06:18016340..18017695 (- strand) : 1356 bp

CDS

chr06:18016130..18016339 (- strand) : 210 bp

3'UTR

chr06:18015556..18016129 (- strand) : 574 bp

FASTA

>Os06t0506600-01 class=Sequence position=chr06:18015556..18017695 (- strand)
CTCCCCACCT CGCGTTCCCT CCCCTCTCCC CTCCGGCCAT GGCGTCCAAG CGGATCCTCA AGGAGCTCAA GGACCTGCAG
AAGGATCCCC CAACCTCCTG CAGCGCTGGT AGGTATCCTC CTCTTCTTCT TCTTCGCTGT CCCCCAATTC CAGGGTTCAC
GGGCGATTTT GTTTCTTGTC GATTCATCGA CTTCTTAGCG TGCCGGCTGC TGGATAGTGG AATCCTCTGT TGACTCTTTA
GCTTTCGAAA AAATTTTGAA CCAAGGGAAG GGGAGGAGGG GGAGGTCATA CTGTGCAGTG CTGCAATTTT GTGTTTGTTT
ATGGTTTTGC TACCAATTTC GTGCATATTA TTATCCCCTG AGCGGGTGTG GAGCTGCGTT TTGTTATAAT TCTGGAGCTG
TTAATTGTTC TTCTTTCGCA AATTTAACGC TTATTACGGC TGGCTGGATA GAAGGATAGA GAGCTCAAGC AGAGACGCTG
GATAGAGGGA TATACGGTTT TAGAGGTTAT TGTTCGTTCA ACCTGCTTAG TTAGGAGTAT ACCTTCGTTG TTTTAGTAAT
TTGTGGAAGC ATGGGGTAGC ATATCTAGGA CATGGATAAG TCTCGTTGGC AATGATACCA GGCCACAATC GTTGTTTACA
ACTCAACAAT TTGTGTAACT GGAACTAATT CTTGTGTACC GATGAAATAA TAATACCCTC AATATGTGTG TGATGATAAT
TGTTCTTGTC TACATGCTAG TGTACCCCAA ACAAGACATG TGGATGTTGT AGAATTGTTT TGATATTTCT AACTGAATGT
GACAACTTGT GTGGCGAATA TTGGTTTCAT GATATGTTCT GTTCAAATGC ATTGCAACAA TTGAGATTGG ATTGGAGTAC
CTTTGTATGA CTAACACGCG AAATACGCCT AACAGGCCCT GTGGGAGAAG ATATGTTCCA CTGGCAAGCT ACGATTATGG
GTCCAGCAGA TAGTCCATAT GCAGGTGGCG TCTTCTTGGT TTCTATTCAC TTCCCTCCAG ACTATCCGTT CAAACCGCCC
AAGGTATACA TTCCTTCCAC TTCTTTTTGT GTTGTTCAGG AAACTGTTTG TTTTTAGGAC TTGTGGAAGT TTATTATAAG
AGCATCACTT GCTTCAATTT TATATAATCT TAAGGCCCTT GAGTAACTGA TTACAAGATA TTTGCTGTTA GGGCTCTGCT
CTAAGCATTC ATAGCTAGGG ATAAAATGTC CTGTTAATTT CAGTCTCAAA GTGGAGTTCT AACTGATCCT TTACAAAGCA
TAATATACCT GTAAATGTTA GTTTTGTAAA GGTCCTGATT CACTTTGGCA AATGTGCGTT ACCAATTCAA CAAACTATGA
AAATGCTTGT TTCTTCCACC ACCATAAAAA AAAATGCTTC ACTTGAGTTC AACGGTCACT GTAGCTTTGT TCTGATAACA
ATCATTTTTC AGGTTGCATT TAAGACAAAG GTTTTCCACC CAAACATCAA CAGTAACGGA AGCATCTGCC TTGATATCCT
GAAGGAACAG TGGAGCCCTG CATTGACAGT GTCAAAGGTG AATTGATCCT CTCCCTCTCC AACTAAGTCA AGAAACCCTT
TGAGACAGCT TGTGCATGTG CAAAAGCTTA GCTTCTTTGA AGTTGTCACA TAGAAACTAC TTACTTGAGA AGTTAGGCAC
TTTGGCACCA TAGAAATGTT AGGAAGTTGG AGCTCTCATA GTCTCTAGGG CTTAACAAAT GCCCAACACC GTATATCACC
TGCGTGCTAA TCTGGTTGGA GTAACTTTTG TTTTCCAGTT GCACGAATTA TCTAACGTTT GACACAATTT TCAGGTACTC
CTCTCAATTT GTTCTCTACT GACGGACCCA AACCCAGACG ACCCGCTAGT TCCGGAGATT GCGCACATGT ACAAGACTGA
TCGGGCCAAA TATGAATCAA CTGCGAGGGG CTGGACCCAG AAATATGCAA TGGGCTGAAC GACGTAGGCC GATAGTGTTC
TCTAGCGATA TATGTTATCT TGTTGATCTA GTGTTCATGT CCTGCTACAT GCCTACATGG GGTGTAATTT CTTCTGTCAC
TGAATTTATG TCAAATTCTC GATTGATGGT AGAAGTTATT GAGAAAAATT TCAATTACCT