Os06t0514100-01

Locus

Os06g0514100

Description

Thionin, Antimicrobial peptide, Defence against root pathogens

RAP-DB Gene Symbol Synonym(s)

OsTHI7

RAP-DB Gene Name Synonym(s)

Thionin 7

CGSNL Gene Symbol

THI7

CGSNL Gene Name

THIONIN 7

Oryzabase Gene Symbol Synonym(s)

OsTHI7, OsTHION7, THION7

Oryzabase Gene Name Synonym(s)

Thionin 7

Transcript Evidence

AK062831

Protein Evidence

Q0DBX6

Literature

PMID: 25676661

Note

Manual Curation

April 14, 2020

Gene Ontology (GO)

Biological Process: defense response (GO:0006952)

Functional domain (InterPro)

Thionin-like superfamily (IPR036391)

Thionin (IPR001010)

Full-length cDNA

001-107-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0514100-01)

Others

Oryzabase (19262)

Transcript

778 bp

>Os06t0514100-01 Thionin, Antimicrobial peptide, Defence against root pathogens
acaaccacaagaccaaggaagcagtagcctttcagccctcttgctttagtttgttgatcc
ccgactaaatctcattggaaaacaagctagaaagcatggaaggagtgaagagtttgatca
tgtgtatgctagtgctaggcttagtcctgcaacaagagaagatccaggtggaagcaaaga
gttgttgcccatccaccacagcaagaaacgtctataactcatgccgtttcgcgggtggct
caagaaacacctgtgctaaactttctggctgcaaaattgttgatgggaactgcgagcctc
cttacgttcaccatacccttcacccagaagctgaggaatcggaggtagttgacttctgca
agctgggatgtgcttcgtctgtgtgcagcaccatgagcactctttttgccaatgaagaag
ccaatcatgccgtcgatcgttgcaacgaagcatgccgccgcttctgtaccaaggaagctg
agactgtcaccgctgtttcctaagcaagtgcaacatgcaagcataagggtcctcacacat
ggaagcccatggtaggctatgctaccctggagtactcagaaataaaatggatatcatgat
atccaatccagtgtgccatcgatctctcttgatttctgtcacgttttatttccaataagc
tatgataatcacgatctgccatcatatattatcttttcttgaggatgtgagcatatgtag
agtgatgatatcattgcctaagaaataaatcttgtcatcgggatggatcccttttgtt

CDS

408 bp

>Os06t0514100-01 Thionin, Antimicrobial peptide, Defence against root pathogens
atggaaggagtgaagagtttgatcatgtgtatgctagtgctaggcttagtcctgcaacaa
gagaagatccaggtggaagcaaagagttgttgcccatccaccacagcaagaaacgtctat
aactcatgccgtttcgcgggtggctcaagaaacacctgtgctaaactttctggctgcaaa
attgttgatgggaactgcgagcctccttacgttcaccatacccttcacccagaagctgag
gaatcggaggtagttgacttctgcaagctgggatgtgcttcgtctgtgtgcagcaccatg
agcactctttttgccaatgaagaagccaatcatgccgtcgatcgttgcaacgaagcatgc
cgccgcttctgtaccaaggaagctgagactgtcaccgctgtttcctaa

Protein

135 aa

>Os06t0514100-01 Thionin, Antimicrobial peptide, Defence against root pathogens
MEGVKSLIMCMLVLGLVLQQEKIQVEAKSCCPSTTARNVYNSCRFAGGSRNTCAKLSGCK
IVDGNCEPPYVHHTLHPEAEESEVVDFCKLGCASSVCSTMSTLFANEEANHAVDRCNEAC
RRFCTKEAETVTAVS*

5'UTR

chr06:18727414..18727508 (- strand) : 95 bp

CDS

chr06:18727176..18727413 (- strand) : 238 bp

chr06:18726926..18726994 (- strand) : 69 bp

chr06:18726712..18726812 (- strand) : 101 bp

3'UTR

chr06:18726437..18726711 (- strand) : 275 bp

FASTA

>Os06t0514100-01 class=Sequence position=chr06:18726437..18727508 (- strand)
acaaccacaa gaccaaggaa gcagtagcct ttcagccctc ttgctttagt ttgttgatcc ccgactaaat ctcattggaa
aacaagctag aaagcatgga aggagtgaag agtttgatca tgtgtatgct agtgctaggc ttagtcctgc aacaagagaa
gatccaggtg gaagcaaaga gttgttgccc atccaccaca gcaagaaacg tctataactc atgccgtttc gcgggtggct
caagaaacac ctgtgctaaa ctttctggct gcaaaattgt tgatgggaac tgcgagcctc cttacgttca ccataccctt
cacccagaag ctggtaaatt agaaacatta gctctccttg tctatatttc tatcttgcat tcaccacgcc cttcacccca
gctaacctag gcaaattaaa acatattaac tccctttgtg taaacttttg ggctattaat tttgtaatat ctattggtac
aagcatttat tcatgcatat acatgatttt gcagaggaat cggaggtagt tgacttctgc aagctgggat gtgcttcgtc
tgtgtgcagc accatgagca ctcgtaagcg agaaaaaaca tcaagctaaa ttaccattga tttgcaacca aaaaaataaa
tattctttgt tctatatagc taatgtatag attgaaacgt ttgttttcct tttcagtttt tgccaatgaa gaagccaatc
atgccgtcga tcgttgcaac gaagcatgcc gccgcttctg taccaaggaa gctgagactg tcaccgctgt ttcctaagca
agtgcaacat gcaagcataa gggtcctcac acatggaagc ccatggtagg ctatgctacc ctggagtact cagaaataaa
atggatatca tgatatccaa tccagtgtgc catcgatctc tcttgatttc tgtcacgttt tatttccaat aagctatgat
aatcacgatc tgccatcata tattatcttt tcttgaggat gtgagcatat gtagagtgat gatatcattg cctaagaaat
aaatcttgtc atcgggatgg atcccttttg tt

Locus: Os06g0514100

Loading...

Locus: Os06g0514100

Loading...