Os06t0519700-00

Locus

Os06g0519700

Description

Similar to Serine carboxypeptidase family protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP35

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 35

Oryzabase Gene Symbol Synonym(s)

OsSCP35

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 35

Transcript Evidence

ab initio prediction

Protein Evidence

Q10DG1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Expression Databases

TENOR (Os06t0519700-00)

Others

Oryzabase (19215)

Transcript

345 bp

>Os06t0519700-00 Similar to Serine carboxypeptidase family protein, expressed.
ATGGGTTCTCATCATCGCCCCACCGCAGGGCAATGCAGCCTCGTGCAGCCACCGCGCCTC
ATCACCTGCCTTCTCCTACTGCTTCTTCTTCTGCTTCTGTCGTCGCCACTGACGCTCCCG
TGCTCGGCGTCGTCGGCGGTGATCACTCACCTCCCGGGCTTCCATGGCCGCCTGCCATTC
TACCTCGAGACTGGGTACATTGGTGTTGAGGAGAAGACTGGCACTGAGCTCTTCTACTAC
TTCGTTGAATCAGAGAGAAACCCTGACACAGACCCTTTGGTACTGTGGCTAGTGGGTGGG
CCCCGTTGTTCGGGCTTCTGTGGCGTTGTCTACGAAGAAGGTTAG

CDS

345 bp

>Os06t0519700-00 Similar to Serine carboxypeptidase family protein, expressed.
ATGGGTTCTCATCATCGCCCCACCGCAGGGCAATGCAGCCTCGTGCAGCCACCGCGCCTC
ATCACCTGCCTTCTCCTACTGCTTCTTCTTCTGCTTCTGTCGTCGCCACTGACGCTCCCG
TGCTCGGCGTCGTCGGCGGTGATCACTCACCTCCCGGGCTTCCATGGCCGCCTGCCATTC
TACCTCGAGACTGGGTACATTGGTGTTGAGGAGAAGACTGGCACTGAGCTCTTCTACTAC
TTCGTTGAATCAGAGAGAAACCCTGACACAGACCCTTTGGTACTGTGGCTAGTGGGTGGG
CCCCGTTGTTCGGGCTTCTGTGGCGTTGTCTACGAAGAAGGTTAG

Protein

115 aa

>Os06t0519700-00 Similar to Serine carboxypeptidase family protein, expressed.
MGSHHRPTAGQCSLVQPPRLITCLLLLLLLLLLSSPLTLPCSASSAVITHLPGFHGRLPF
YLETGYIGVEEKTGTELFYYFVESERNPDTDPLVLWLVGGPRCSGFCGVVYEEG*

CDS

chr06:19039409..19039602 (+ strand) : 194 bp

chr06:19039720..19039870 (+ strand) : 151 bp

FASTA

>Os06t0519700-00 class=Sequence position=chr06:19039409..19039870 (+ strand)
ATGGGTTCTC ATCATCGCCC CACCGCAGGG CAATGCAGCC TCGTGCAGCC ACCGCGCCTC ATCACCTGCC TTCTCCTACT
GCTTCTTCTT CTGCTTCTGT CGTCGCCACT GACGCTCCCG TGCTCGGCGT CGTCGGCGGT GATCACTCAC CTCCCGGGCT
TCCATGGCCG CCTGCCATTC TACCTCGAGA CTGGGTAAGC ACTACTCACC GAGAGTCCCA TTTTCTTCTA CATACTACTA
CTATACGAGC ATAAACTCAT CACATAGAAT TGGGTACATA TGCACGTACA TGTGTAATGT ATACACAATA GGTACATTGG
TGTTGAGGAG AAGACTGGCA CTGAGCTCTT CTACTACTTC GTTGAATCAG AGAGAAACCC TGACACAGAC CCTTTGGTAC
TGTGGCTAGT GGGTGGGCCC CGTTGTTCGG GCTTCTGTGG CGTTGTCTAC GAAGAAGGTT AG