Os06t0530400-01

Locus

Os06g0530400

Description

Similar to NAC domain-containing protein 76.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC7

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 7

Oryzabase Gene Symbol Synonym(s)

OsNAC7, ONAC076, NAC76, OsNAC7/ONAC093, ONAC093, ONAC93, NAC93, DLN167, OsDLN167

Oryzabase Gene Name Synonym(s)

OsNAC7 protein, NAC domain-containing protein 76, NAC domain-containing protein 093, NAC domain-containing protein 93, DLN repressor 167, DLN motif protein 167

Transcript Evidence

AK102224 (DDBJ, Best hit)

Protein Evidence

Q5Z6B6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J033087M22 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0530400-01)

RiceXPro (AK102224)

Others

Oryzabase (6234)

KEGG (Os06t0530400-01)

Transcript

2186 bp

>Os06t0530400-01 Similar to NAC domain-containing protein 76.
ATCCTCTTCCTCTTGTTTTTCTTGCTGCTTGTCCCTATCTTTTTGTTGCATTGAGGAGCT
GATGAGCTGAGCTAATCAGGGCAGAACAAAGGCAGGAGGATATAGTTTTCCAAGATCCTA
GGGCCGGCCTGCATCAAAAAGAAGGATGCATCCGAGCGGCGGCGCGCTGTCGGtgccacc
ggggtttcggttccacccgacggacgaggagctcctctactactacctgaggaagaaggt
ggcctacgaggccatagatctcgacgtcataagggagatcgacctcaacaagctcgagcc
ctgggatctcaaagatcggtgcaggatagggacggggcctcagaacgagtggtacttctt
cagccacaaggacaagaagtacccgacggggacgaggacgaaccgggcgacgacggcggg
gttctggaaggcgacggggagggacaaggccatcttcctcgccaacgcctgccgcatcgg
catgaggaagaccctcgtcttctacgtcggcagggcgccccacggcaagaagaccgactg
gatcatgcacgagtaccgcctCGACCAAGACAACGTCGATGTCCAGGTATATATATATAT
ATATATATATATATATTTGACATCAGCAAAAACCATATGCAACATTAAGTTCACGATATA
CATACTTAGCATCCATGAAATGCCAAAGTCATGCATGATATCACGACTCATGAGTACTGG
tactccctccgtccaaatatataagtatttctagctatgaacttgaacaactgcgtgttt
agattcatagctaaaagttactatattttgggacgAATTGCAGTTATGCTAGTTTTGCTA
TTTATCAGTCATCTAGAACTTTGTTATTTTGTCAGTTACCTACATGAATTTGTGTGTACT
ATGTATATGCAATTGGTGGTTGATCCAAAGAGAATAAAGTTTCAGGCTGAGAATTAGTAA
AAAGGGATATGTGTGTTGTACAGAAAGATTCACCTTCATGGAACCTTGCATATATAGCTC
AAGGGTTTCTTGCTACTGAGATTGATGAACTAATTAACAGCTTAATTAATTTACTGAGAT
TCATTGTCTGATCTGAAAATGAAAATACATCATTGCAGGAAGATGGTTGGGTGGTGTGTA
GGGTATTCATGAAGAAGAGCTACCAGCGAGGCCTCAACCCGGCGGACATGGCGGCGGTCG
ACGACGACGACCTCCTCCACCACCACCACCACCCCTTCCCACCGGCCCAGCTCCACGGCG
GCGCCGCCGACCACAAGCACGACGGCGCCGGCGGCCACCACCACCACCACCTCATGCAGC
CGCACCACCACTACGACGACTTCCCTTCCTTCGACCCCTCCATGCAGCTCCCCCAGCTCA
TGAGCGCCGACCAGCcgccgccgccaccgccgtccctcctccccggcgtcccaccctccg
ccgccgctgccttgagctccctcgacgtcgagtgcccccagaacctcatgaagctaacgt
cggccgccgccggaggcggtgccaccgggctgctccacgccggcggcgaccaccgcttcg
ccaccgccgccacggactggtccatcctggacaagctcctcgcctcgcaccagaacctgg
accagctcttccagggcagggtcatcgccggagcgtcgtcgccgGCTGCCATGGCTGCTC
CTAGCCACCACCAGCATCTCATGGATCAGCTCGCCGGCGGCGGCGGCGGCACCGCCTCGT
CGTTGCAGAGGCTTCCACTGCAGTATCTGGGGTGCGAGGCAGCCGACCTGCTCAGGTTCT
CCAAGTAGAGAGATTATCCCTCCATGCATGCATGGATCACTTGAACTAAGCTAGCTTAAT
TAGCTGCCACCGATAAATGAGCAGTTGATGATGGTGATGATGATCTGAATGATCAGCTCA
TGTTTTTTTGGTTAGACTGGTTAATTTGATCTTCCTTTTGGTATGGAGCTTAATGCTTCC
AAGTGTATATACACTCTATGCTATGCTATGCTATGTTTTCCCATGTGCATGCATGCAAAT
GTGGCTTTGAAACCTAATTATACATGCATGAGAATACTTAATTAATATTTCTGATTTTCC
CATGCATTTTTGGATTTAAGTGTTGCTTCTTAATTAGGATGCTTCATAATTGCTGGCTGA
TGAATGAGAACCGATATTAATTTACC

CDS

609 bp

>Os06t0530400-01 Similar to NAC domain-containing protein 76.
ATGCATCCGAGCGGCGGCGCGCTGTCGGtgccaccggggtttcggttccacccgacggac
gaggagctcctctactactacctgaggaagaaggtggcctacgaggccatagatctcgac
gtcataagggagatcgacctcaacaagctcgagccctgggatctcaaagatcggtgcagg
atagggacggggcctcagaacgagtggtacttcttcagccacaaggacaagaagtacccg
acggggacgaggacgaaccgggcgacgacggcggggttctggaaggcgacggggagggac
aaggccatcttcctcgccaacgcctgccgcatcggcatgaggaagaccctcgtcttctac
gtcggcagggcgccccacggcaagaagaccgactggatcatgcacgagtaccgcctCGAC
CAAGACAACGTCGATGTCCAGGTATATATATATATATATATATATATATATTTGACATCA
GCAAAAACCATATGCAACATTAAGTTCACGATATACATACTTAGCATCCATGAAATGCCA
AAGTCATGCATGATATCACGACTCATGAGTACTGGtactccctccgtccaaatatataag
tatttctag

Protein

203 aa

>Os06t0530400-01 Similar to NAC domain-containing protein 76.
MHPSGGALSVPPGFRFHPTDEELLYYYLRKKVAYEAIDLDVIREIDLNKLEPWDLKDRCR
IGTGPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIFLANACRIGMRKTLVFY
VGRAPHGKKTDWIMHEYRLDQDNVDVQVYIYIYIYIYLTSAKTICNIKFTIYILSIHEMP
KSCMISRLMSTGTPSVQIYKYF*

5'UTR

chr06:19746238..19746351 (- strand) : 114 bp

chr06:19746036..19746066 (- strand) : 31 bp

CDS

chr06:19745867..19746035 (- strand) : 169 bp

chr06:19745297..19745736 (- strand) : 440 bp

3'UTR

chr06:19743865..19745296 (- strand) : 1432 bp

FASTA

>Os06t0530400-01 class=Sequence position=chr06:19743865..19746351 (- strand)
ATCCTCTTCC TCTTGTTTTT CTTGCTGCTT GTCCCTATCT TTTTGTTGCA TTGAGGAGCT GATGAGCTGA GCTAATCAGG
GCAGAACAAA GGCAGGAGGA TATAGTTTTC CAAGGTTTGT GCTCTTCCTT TTGTTCTGTT TTAGCCCTAT GCATGAAGAG
GAAGGTATAT AGTCAAGATT GCATGCACTT CTCTGATTCA AAGGTTGCTT TTCAAGCTAG TAACTCAAGT AGATGATCTT
CTGGTGTTTC TCTCCCAAAT CTAAACAATG TCTGAATCTC ATCAGATCCT AGGGCCGGCC TGCATCAAAA AGAAGGATGC
ATCCGAGCGG CGGCGCGCTG TCGGtgccac cggggtttcg gttccacccg acggacgagg agctcctcta ctactacctg
aggaagaagg tggcctacga ggccatagat ctcgacgtca taagggagat cgacctcaac aagctcgagc cctgggatct
caaaggtaaa attgaaattg agcaatcaat cagtcagctc atctagctag ccggccggag ctagcaagca tgcaacagtg
agatttagct gaagtttaaa catggtgatt aatatttcat gtggtatata tacagatcgg tgcaggatag ggacggggcc
tcagaacgag tggtacttct tcagccacaa ggacaagaag tacccgacgg ggacgaggac gaaccgggcg acgacggcgg
ggttctggaa ggcgacgggg agggacaagg ccatcttcct cgccaacgcc tgccgcatcg gcatgaggaa gaccctcgtc
ttctacgtcg gcagggcgcc ccacggcaag aagaccgact ggatcatgca cgagtaccgc ctCGACCAAG ACAACGTCGA
TGTCCAGGTA TATATATATA TATATATATA TATATATTTG ACATCAGCAA AAACCATATG CAACATTAAG TTCACGATAT
ACATACTTAG CATCCATGAA ATGCCAAAGT CATGCATGAT ATCACGACTC ATGAGTACTG Gtactccctc cgtccaaata
tataagtatt tctagctatg aacttgaaca actgcgtgtt tagattcata gctaaaagtt actatatttt gggacgAATT
GCAGTTATGC TAGTTTTGCT ATTTATCAGT CATCTAGAAC TTTGTTATTT TGTCAGTTAC CTACATGAAT TTGTGTGTAC
TATGTATATG CAATTGGTGG TTGATCCAAA GAGAATAAAG TTTCAGGCTG AGAATTAGTA AAAAGGGATA TGTGTGTTGT
ACAGAAAGAT TCACCTTCAT GGAACCTTGC ATATATAGCT CAAGGGTTTC TTGCTACTGA GATTGATGAA CTAATTAACA
GCTTAATTAA TTTACTGAGA TTCATTGTCT GATCTGAAAA TGAAAATACA TCATTGCAGG AAGATGGTTG GGTGGTGTGT
AGGGTATTCA TGAAGAAGAG CTACCAGCGA GGCCTCAACC CGGCGGACAT GGCGGCGGTC GACGACGACG ACCTCCTCCA
CCACCACCAC CACCCCTTCC CACCGGCCCA GCTCCACGGC GGCGCCGCCG ACCACAAGCA CGACGGCGCC GGCGGCCACC
ACCACCACCA CCTCATGCAG CCGCACCACC ACTACGACGA CTTCCCTTCC TTCGACCCCT CCATGCAGCT CCCCCAGCTC
ATGAGCGCCG ACCAGCcgcc gccgccaccg ccgtccctcc tccccggcgt cccaccctcc gccgccgctg ccttgagctc
cctcgacgtc gagtgccccc agaacctcat gaagctaacg tcggccgccg ccggaggcgg tgccaccggg ctgctccacg
ccggcggcga ccaccgcttc gccaccgccg ccacggactg gtccatcctg gacaagctcc tcgcctcgca ccagaacctg
gaccagctct tccagggcag ggtcatcgcc ggagcgtcgt cgccgGCTGC CATGGCTGCT CCTAGCCACC ACCAGCATCT
CATGGATCAG CTCGCCGGCG GCGGCGGCGG CACCGCCTCG TCGTTGCAGA GGCTTCCACT GCAGTATCTG GGGTGCGAGG
CAGCCGACCT GCTCAGGTTC TCCAAGTAGA GAGATTATCC CTCCATGCAT GCATGGATCA CTTGAACTAA GCTAGCTTAA
TTAGCTGCCA CCGATAAATG AGCAGTTGAT GATGGTGATG ATGATCTGAA TGATCAGCTC ATGTTTTTTT GGTTAGACTG
GTTAATTTGA TCTTCCTTTT GGTATGGAGC TTAATGCTTC CAAGTGTATA TACACTCTAT GCTATGCTAT GCTATGTTTT
CCCATGTGCA TGCATGCAAA TGTGGCTTTG AAACCTAATT ATACATGCAT GAGAATACTT AATTAATATT TCTGATTTTC
CCATGCATTT TTGGATTTAA GTGTTGCTTC TTAATTAGGA TGCTTCATAA TTGCTGGCTG ATGAATGAGA ACCGATATTA
ATTTACC

Locus: Os06g0530400

Loading...

Locus: Os06g0530400

Loading...