Os06t0531200-01

Locus

Os06g0531200

Description

ThiJ/PfpI domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1E, DJ-1E

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein E, DJ-1 protein E

Transcript Evidence

AK105855 (DDBJ, Best hit)

AK072614 (DDBJ, Best hit)

Protein Evidence

B8B3B1 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-203-H05 (Online Clone Ordering)

J023133K03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0531200-01)

Others

Oryzabase (20916)

Transcript

1495 bp

>Os06t0531200-01 ThiJ/PfpI domain containing protein.
ACTCTTCTTCCTCCCCTCCGCTTCTGCTCCCCTCTCAAAACCCCACCTCCCTCTCCTCCT
CCTCCTCACCTCCGCCGCCTCCAAACCCTAACCCGCGCGCTCGCCTCCTCCTCCTCAGCC
ATGGCGTCGCCGCCCGCGAAGAAGGTGCTGGTGCCGATCGCGAGCGGGACGGAGCCGATG
GAGGCCGTCATCACCGTCGACGTGCTCCGCCGCGCCGGGGCCGACGTCTCCGTCGCCTCC
GTCGACCCCGGCTCCGCGCAGGTCGGCGGAGCCTGGGGCGTCAAGCTGGCCGCGGACGCG
CTGCTCGACGACCTCGCCGACGCCGAATTCGACCTCATCTCGCTCCCGGGAGGTATGCCA
GGGTCTTCCAATCTTAGAGACTGCAAACTTCTGGAGAACATGGTTAAAAAGCACGCAGGA
AAGGGCAAACTTTATGCTGCAATATGTGCTGCACCAGCTGTCGCTCTAGGATCATGGGGT
TTGCTGAATGGATTGAAGGCAACTTGTTATCCTTCATTCATGGATAAACTTCCTTCAGAG
GTCAATGCTGTAGAATCGAGGGTGCAGATTGATGGGAACTGTGTGACCAGTCGAGGACCA
GGAACGGCCATGGAGTATTCTGTTGTTTTGGTCGAACAATTATATGGCAAAGAAAAAGCT
GATGAAGTTGCTGGTCCAATGGTCATGCGCCCCCAGCATGGTGTGGAGTTCTCATTGAAA
GAGTTGAATTCAACTAGTTGGAATGTTGGTGAAACACCTCAGATTCTTGTACCAATTGCT
AATGGGACAGAGGAGATGGAAGCAACTATGATAATCGACATCCTCAGAAGGGCGAAAGCA
AATGTTGTCGTTGCGTCCTTGGAGGAAACTTTGGAGATTGTTGCATCCAGGAAAGTGAAG
ATGGTTGCTGATGTTCTGTTGGATGATGCTCTTAAGCAGCAATATGATCTCATTTTGTTA
CCAGGTGGTCTTGGTGGTGCCCAAGCATATGCAAAGTCAGATAAACTGATTGGTCTGATC
AAGAAGCAAGCTGAGGCAAACAAGCTATATGGAGCTATATGTGCCTCGCCAGCAATCGCC
CTTGAACCACATGGCCTGCTGAAGGGAAAGAAGGCTACATCCTTTCCTGGTATGTGGAAC
AAGCTCTCGGACCAAAGCGAATGCAAGAACAGGGTTGTCGTTGATGGCAACCTAATCACC
AGCCAAGGTCCAGGCACATCCATGGAGTTCTCTCTCGCCATCGTGGAGAAGCTGTTTGGT
CGGGAGAGGGCCGTCGAGCTCGCCAAAACCATGGTCTTCATGTGAGTTGTGTTGTTACAT
ACTACGTGTAAGACAACACCATAGTCAGACTCTGAATATGAGGCATCCTTTTGCTCGTAG
CTGGTGTGGTGGAAAGCACTTCGTAATCCTTTTTTTTGGCTTTCTCTTCCACAATAACAC
GACGTCTTGTTATGTGTACAACCGTACAAATGCAATAAAAAGAGATGGATATTGC

CDS

1185 bp

>Os06t0531200-01 ThiJ/PfpI domain containing protein.
ATGGCGTCGCCGCCCGCGAAGAAGGTGCTGGTGCCGATCGCGAGCGGGACGGAGCCGATG
GAGGCCGTCATCACCGTCGACGTGCTCCGCCGCGCCGGGGCCGACGTCTCCGTCGCCTCC
GTCGACCCCGGCTCCGCGCAGGTCGGCGGAGCCTGGGGCGTCAAGCTGGCCGCGGACGCG
CTGCTCGACGACCTCGCCGACGCCGAATTCGACCTCATCTCGCTCCCGGGAGGTATGCCA
GGGTCTTCCAATCTTAGAGACTGCAAACTTCTGGAGAACATGGTTAAAAAGCACGCAGGA
AAGGGCAAACTTTATGCTGCAATATGTGCTGCACCAGCTGTCGCTCTAGGATCATGGGGT
TTGCTGAATGGATTGAAGGCAACTTGTTATCCTTCATTCATGGATAAACTTCCTTCAGAG
GTCAATGCTGTAGAATCGAGGGTGCAGATTGATGGGAACTGTGTGACCAGTCGAGGACCA
GGAACGGCCATGGAGTATTCTGTTGTTTTGGTCGAACAATTATATGGCAAAGAAAAAGCT
GATGAAGTTGCTGGTCCAATGGTCATGCGCCCCCAGCATGGTGTGGAGTTCTCATTGAAA
GAGTTGAATTCAACTAGTTGGAATGTTGGTGAAACACCTCAGATTCTTGTACCAATTGCT
AATGGGACAGAGGAGATGGAAGCAACTATGATAATCGACATCCTCAGAAGGGCGAAAGCA
AATGTTGTCGTTGCGTCCTTGGAGGAAACTTTGGAGATTGTTGCATCCAGGAAAGTGAAG
ATGGTTGCTGATGTTCTGTTGGATGATGCTCTTAAGCAGCAATATGATCTCATTTTGTTA
CCAGGTGGTCTTGGTGGTGCCCAAGCATATGCAAAGTCAGATAAACTGATTGGTCTGATC
AAGAAGCAAGCTGAGGCAAACAAGCTATATGGAGCTATATGTGCCTCGCCAGCAATCGCC
CTTGAACCACATGGCCTGCTGAAGGGAAAGAAGGCTACATCCTTTCCTGGTATGTGGAAC
AAGCTCTCGGACCAAAGCGAATGCAAGAACAGGGTTGTCGTTGATGGCAACCTAATCACC
AGCCAAGGTCCAGGCACATCCATGGAGTTCTCTCTCGCCATCGTGGAGAAGCTGTTTGGT
CGGGAGAGGGCCGTCGAGCTCGCCAAAACCATGGTCTTCATGTGA

Protein

395 aa

>Os06t0531200-01 ThiJ/PfpI domain containing protein.
MASPPAKKVLVPIASGTEPMEAVITVDVLRRAGADVSVASVDPGSAQVGGAWGVKLAADA
LLDDLADAEFDLISLPGGMPGSSNLRDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWG
LLNGLKATCYPSFMDKLPSEVNAVESRVQIDGNCVTSRGPGTAMEYSVVLVEQLYGKEKA
DEVAGPMVMRPQHGVEFSLKELNSTSWNVGETPQILVPIANGTEEMEATMIIDILRRAKA
NVVVASLEETLEIVASRKVKMVADVLLDDALKQQYDLILLPGGLGGAQAYAKSDKLIGLI
KKQAEANKLYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQSECKNRVVVDGNLIT
SQGPGTSMEFSLAIVEKLFGRERAVELAKTMVFM*

5'UTR

chr06:19829475..19829594 (- strand) : 120 bp

CDS

chr06:19829450..19829474 (- strand) : 25 bp

chr06:19829125..19829327 (- strand) : 203 bp

chr06:19827766..19827915 (- strand) : 150 bp

chr06:19827497..19827679 (- strand) : 183 bp

chr06:19826595..19826675 (- strand) : 81 bp

chr06:19825693..19825893 (- strand) : 201 bp

chr06:19825074..19825214 (- strand) : 141 bp

chr06:19824749..19824949 (- strand) : 201 bp

3'UTR

chr06:19824559..19824748 (- strand) : 190 bp

FASTA

>Os06t0531200-01 class=Sequence position=chr06:19824559..19829594 (- strand)
ACTCTTCTTC CTCCCCTCCG CTTCTGCTCC CCTCTCAAAA CCCCACCTCC CTCTCCTCCT CCTCCTCACC TCCGCCGCCT
CCAAACCCTA ACCCGCGCGC TCGCCTCCTC CTCCTCAGCC ATGGCGTCGC CGCCCGCGAA GAAGGCAAGC GTTCCCCCCT
CTCGCAGCCG TGTTTTTGGA TTTTTGGTTC CCCCTCCCCT GAGAATCTGA CTGGTTGAGG TGGGGGGATG GTGTGTGCGC
GTTTGTCTGT GATGATGATG GTGCAGGTGC TGGTGCCGAT CGCGAGCGGG ACGGAGCCGA TGGAGGCCGT CATCACCGTC
GACGTGCTCC GCCGCGCCGG GGCCGACGTC TCCGTCGCCT CCGTCGACCC CGGCTCCGCG CAGGTCGGCG GAGCCTGGGG
CGTCAAGCTG GCCGCGGACG CGCTGCTCGA CGACCTCGCC GACGCCGAAT TCGACCTCAT CTCGCTCCCG GTGAGTGGAG
TTGCCCGCCC ACCCCGCCGC ACGGCTCGTC AGTAGTCGCG TCCCGTGTTA ACTGTACATG GTTGTTTCGT GTTTGGGGAA
CCCACAAATT GGATGGGGGA GAATGGGTGG TTTTGAGTCG CTTACAACGC TGACCAAGTG AAATTAATTG CGTTTCCTTC
GAAATCATTT ATACCTGACC TGAGCACAAG TTTGTGAATT GTATGCGAGC AAACTAGTGC TCTGTTGTAG TATTTTGATG
TTGTGATAAA ACAATCAAAG TATTGCGTAT TTGGTTATAA GACAAGGTCA CGAGGGCACT ATGTGAGTGA TAATAAGtac
tccctccgtt tcacaattta agtcattcgc atttcccaca ttcatattga tgttaatgaa tctagacata tatatttatc
tagattcatt aacatcaata tggatatgga aaatgttaga atgacttaca ttgtgaaacg gaggaagtaT GATAGTTTAT
AACCCACTGA GCATGTCAAA TTGACAATTG AATTCTATTA GTGCTTTCCT GAATGGGGAG GGTAAATGCC ACTTCTCAGA
AGCTGCAGGT AAGAAATTTC CGTGTTTCTT AGCTTTGCTT AAGTGTACTT CTTCATGTTA AATGTAAATG TGCTGTCTCC
TGCTATCATC AATACTAAAA ACATCAGGAG CAGTAATTTA ATGACTGAGT TTTTTTAATG GTGGATGCCG TTGAGGTGAA
TGGATCATGT TTATAAAGGA CATAGCTGGT GAGGCATTCT CAGGTCTCAG CTATGGAACA CTTAGGATTT AATGATACCT
AATGTTAAAG GCATGTATGG TTTGCTGAAG CTAGCAAGCA GAATTCAATA CTAATATTGG TTTATTGAAG CTTTATGTGC
TTGATAGCAT TCATATCTGT AGCCCTGAGT CACTGACTGA TAAAACATGC TCCAGCCATC TCAAACTTGA TTGTCCCAGC
AATTTTGGCC AAACAGATTA ATGTGCATTC CTTTTCCTCA ATATTTCTTT TTGGTGTACA ATGTACATGT ATGTTATTGT
CAGTCATGCT ACTCATTTGT AACTCCTGCA GTTCTGTTTT GCGCTACAAG TGTCTAAGGG GGTCCAAAAG CTTGTCCAGA
AAAAAAAGAA TTGGTTTGGT CTATTATCCC CCCTGCTTAT ATCTGACATT TTGATCCATT TGGGTTGTGT TTTTTTTAGG
GAGGTATGCC AGGGTCTTCC AATCTTAGAG ACTGCAAACT TCTGGAGAAC ATGGTTAAAA AGCACGCAGG AAAGGGCAAA
CTTTATGCTG CAATATGTGC TGCACCAGCT GTCGCTCTAG GATCATGGGG TTTGCTGAAT GGATTGAAGG TGGTCTTTTC
ATCATTAGTT GGCTCTTGCA TACACAATAT TATTACTTTT CAATTCTAAG AAGCTTGTTT TGCCTTTTGT GACAGGCAAC
TTGTTATCCT TCATTCATGG ATAAACTTCC TTCAGAGGTC AATGCTGTAG AATCGAGGGT GCAGATTGAT GGGAACTGTG
TGACCAGTCG AGGACCAGGA ACGGCCATGG AGTATTCTGT TGTTTTGGTC GAACAATTAT ATGGCAAAGA AAAAGCTGAT
GAAGTTGCTG GTCCAATGGT AGGAATCGTT TTGAACATTG GATTGCATAC AGTTGTTAGG AATGCGTTTT CTTATATTTC
CATTGCAGAA AGGCATTTGA AAAGAATAAT TTGGAGGTAA ATATTTGCAT TCTGCATTTT AGAGAAAACT TTACTCTGTG
GTTTCTTATT TGAAGTTTAT TAGACTGCTG TTTAGCGTAG AAGTGTAGTG TGCCTGCTTT GACTAATAAT TTGAAGTGTG
GATATTGCAC GGATGACATT CGTGTTCATC ATCTTATGTG CTAATTTATG CTTCATCATG CAGAATTAAT TGAAATACAT
TTACCTTGTC ATGCATGAGA AACCATTTGC ATCAAATCTT AAATCGCAGA CTTTTCCATG CAACTTCATT CTACTTTTGT
TTGATATCAT TCTTGAGATG AAGATTTTAA CTCATTAGTA TTTTTTGATG TGGTGAATCA TGATGAAATT TCTATCTTCT
AACTTGAGGT ATTATAGTTT ATGCTAAAAC TAGAAAACAT TCTATTTGAA ACTATGGCCA TTTTGGGATA TGTAGAATCT
AATTGGCCTT AAAAAGCCTT TGCTCCCTGC CATCTTATTC CTAGTCAAAA CTGGCTATAG TTGCATTTGA AATTTCTTCA
ATGTGTTGTT TTTATAAAAT TCGTACATTG AAGTACTTTT TTCACACATG GACTGCAAAG GTTAATTTCG ATTGAGTAGC
TTTTCTCTAT GATACTTGTA CTGCTGTTTT GTTTTTTCGG GTTTGTAATT TTTTCAGTAG TGTTTACATA TTTTCCACAG
CTGATGCTTG CATTTAATTT AGTGCTTACA TCTTTTAAGG TCATGCGCCC CCAGCATGGT GTGGAGTTCT CATTGAAAGA
GTTGAATTCA ACTAGTTGGA ATGTTGGTGA AACACCTCAG GTATTCAAAG TTCAGTATGG AAACTACTTG TTACATGTAG
CACTCATTTT CTTTTGTTTC ATGGCAATGT ATACACTATA TAAAATTTTA TGTTGCCTGG AGTAACAATT TGTAGTCTGC
TATGTTTGGT GAAAATGGGC AAGTTTTCTA GTAAAGCTTC CTAAATACCA AGAGGTAGGA TAAGGCAGTA TATGGTAAAC
TGTGTAATTT AATGACAAGA GAAGGGAAGT CATCTTGAAA TGGCAAAACC TCTTCATAAC TCTTTTCATT CACTGCGTTC
TTAGTGATGC TAAATCCCTA GATTTGATAG ATTTAAGATG AGGGCTGGGT AGTGATGCAT GTAGTTTGTC GGTTACTTTC
AAGAGTTTGT TGGATGAAAT ATAGTATGTC TAGCTGGATT AATAATATGA TAGGAGGGAT GTGAGTTGGG ATTTATGTTT
GTTAAGGATT TAGCACATGA TTAAAGATAA ATCCTAGTAG CTACTGTCAA GGAATTAAAA TGCTCTTTTG TGGACCATCA
ATCGATTGAA GTTATTTTGC AGGTTTGATG TTACATGTGA TTATTTAGGT GAACTTACGC TTGTTGCTTC TCTGCTTTCT
ATCATTTTTG TCATTGGCTT AAACATGGAG TAACAGCTTA CATGTTCAAA CTATGTGTTG CTGCTTGGTT TCACCAGCAA
GATCTTGTTC TTGTGCTGCA GATTCTTGTA CCAATTGCTA ATGGGACAGA GGAGATGGAA GCAACTATGA TAATCGACAT
CCTCAGAAGG GCGAAAGCAA ATGTTGTCGT TGCGTCCTTG GAGGAAACTT TGGAGATTGT TGCATCCAGG AAAGTGAAGA
TGGTTGCTGA TGTTCTGTTG GATGATGCTC TTAAGCAGCA ATATGATCTC ATTTTGTTAC CAGTAAGTTT AGTGAATCAA
TGGGTATTTC AATTTTGACC TTAACTAAAT AACAGATATT TGCACCCCCC CCCCCAAAAA AAAAAAAAAT TCTGAAAGCA
GACAGAGAAA ACACTCCACC CTATTCCATT GTGGATTTGG TTAATATGGT GGTAGTTTTT GCTGATTTGA ACTATTAGTT
GAGTTTCATT GATGTGTACT CAACCACGTG GTGTCTACAG TTCTACACCA ACAAAACATG TATCCATATA TGTCTAAATT
TGCAAAAACC ACTGCCATAT TAATTATAAG GTGATGGAAT ATGGTTCAAG GTGTTTGTCT CGTTTGGAAT TTAAGAGCGA
AAACAACTGT TTTTTGAATG TTAAGGTGAA AAATGGACTT CAAGAAGTAT TTCAAGGGAA CGTTGGACTT TAGATTAATT
TAATGTCTAA TAATTTATAA TCTAGCTTGC TGGTTAAATG ACCTTCCATG TTTTCTGTAG GGTGGTCTTG GTGGTGCCCA
AGCATATGCA AAGTCAGATA AACTGATTGG TCTGATCAAG AAGCAAGCTG AGGCAAACAA GCTATATGGA GCTATATGTG
CCTCGCCAGC AATCGCCCTT GAACCACATG GCCTGCTGAA GGTATATACA GCTGTCTATC ATGCGATGAA CATAAATCCT
TGTGGTGCAA ACATGCAGAA ACACCTGTTC TTTTACTGGG AAGACAAATC TTTTTTGACT GGTATGTAAC ATGTTTTTGC
ATCAGGGAAA GAAGGCTACA TCCTTTCCTG GTATGTGGAA CAAGCTCTCG GACCAAAGCG AATGCAAGAA CAGGGTTGTC
GTTGATGGCA ACCTAATCAC CAGCCAAGGT CCAGGCACAT CCATGGAGTT CTCTCTCGCC ATCGTGGAGA AGCTGTTTGG
TCGGGAGAGG GCCGTCGAGC TCGCCAAAAC CATGGTCTTC ATGTGAGTTG TGTTGTTACA TACTACGTGT AAGACAACAC
CATAGTCAGA CTCTGAATAT GAGGCATCCT TTTGCTCGTA GCTGGTGTGG TGGAAAGCAC TTCGTAATCC TTTTTTTTGG
CTTTCTCTTC CACAATAACA CGACGTCTTG TTATGTGTAC AACCGTACAA ATGCAATAAA AAGAGATGGA TATTGC

Locus: Os06g0531200

Loading...

Locus: Os06g0531200

Loading...