Os06t0531200-02

Locus

Os06g0531200

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1E, DJ-1E

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein E, DJ-1 protein E

Transcript Evidence

AK060016 (DDBJ, Best hit)

Protein Evidence

B9FTL1 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

ThiJ/PfpI (IPR002818)

DJ-1 (IPR006287)

Full-length cDNA

006-302-F09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0531200-02)

RiceXPro (AK060016)

Others

Oryzabase (20916)

KEGG (Os06t0531200-02)

Transcript

1099 bp

>Os06t0531200-02 Hypothetical conserved gene.
TGCTGCAATATGTGCTGCACCAGCTGTCGCTCTAGGATCATGGGGTTTGCTGAATGGATT
GAAGGCAACTTGTTATCCTTCATTCATGGATAAACTTCCTTCAGAGGTCAATGCTGTAGA
ATCGAGGGTGCAGATTGATGGGAACTGTGTGACCAGTCGAGGACCAGGAACGGCCATGGA
GTATTCTGTTGTTTTGGTCGAACAATTATATGGCAAAGAAAAAGCTGATGAAGTTGCTGG
TCCAATGGTCATGCGCCCCCAGCATGGTGTGGAGTTCTCATTGAAAGAGTTGAATTCAAC
TAGTTGGAATGTTGGTGAAACACCTCAGATTCTTGTACCAATTGCTAATGGGACAGAGGA
GATGGAAGCAACTATGATAATCGACATCCTCAGAAGGGCGAAAGCAAATGTTGTCGTTGC
GTCCTTGGAGGAAACTTTGGAGATTGTTGCATCCAGGAAAGTGAAGATGGTTGCTGATGT
TCTGTTGGATGATGCTCTTAAGCAGCAATATGATCTCATTTTGTTACCAGGTGGTCTTGG
TGGTGCCCAAGCATATGCAAAGTCAGATAAACTGATTGGTCTGATCAAGAAGCAAGCTGA
GGCAAACAAGCTATATGGAGCTATATGTGCCTCGCCAGCAATCGCCCTTGAACCACATGG
CCTGCTGAAGGGAAAGAAGGCTACATCCTTTCCTGGTATGTGGAACAAGCTCTCGGACCA
AAGCGAATGCAAGAACAGGGTTGTCGTTGATGGCAACCTAATCACCAGCCAAGGTCCAGG
CACATCCATGGAGTTCTCTCTCGCCATCGTGGAGAAGCTGTTTGGTCGGGAGAGGGCCGT
CGAGCTCGCCAAAACCATGGTCTTCATGTGAGTTGTGTTGTTACATACTACGTGTAAGAC
AACACCATAGTCAGACTCTGAATATGAGGCATCCTTTTGCTCGTAGCTGGTGTGGTGGAA
AGCACTTCGTAATCCTTTTTTTTGGCTTTCTCTTCCACAATAACACGACGTCTTGTTATG
TGTACAACCGTACAAATGCAATAAAAAGAGATGGATATTGCACCTTTGGGTTGGGGGGGG
GGGGTATATGATGATGGTA

CDS

870 bp

>Os06t0531200-02 Hypothetical conserved gene.
GCTGCAATATGTGCTGCACCAGCTGTCGCTCTAGGATCATGGGGTTTGCTGAATGGATTG
AAGGCAACTTGTTATCCTTCATTCATGGATAAACTTCCTTCAGAGGTCAATGCTGTAGAA
TCGAGGGTGCAGATTGATGGGAACTGTGTGACCAGTCGAGGACCAGGAACGGCCATGGAG
TATTCTGTTGTTTTGGTCGAACAATTATATGGCAAAGAAAAAGCTGATGAAGTTGCTGGT
CCAATGGTCATGCGCCCCCAGCATGGTGTGGAGTTCTCATTGAAAGAGTTGAATTCAACT
AGTTGGAATGTTGGTGAAACACCTCAGATTCTTGTACCAATTGCTAATGGGACAGAGGAG
ATGGAAGCAACTATGATAATCGACATCCTCAGAAGGGCGAAAGCAAATGTTGTCGTTGCG
TCCTTGGAGGAAACTTTGGAGATTGTTGCATCCAGGAAAGTGAAGATGGTTGCTGATGTT
CTGTTGGATGATGCTCTTAAGCAGCAATATGATCTCATTTTGTTACCAGGTGGTCTTGGT
GGTGCCCAAGCATATGCAAAGTCAGATAAACTGATTGGTCTGATCAAGAAGCAAGCTGAG
GCAAACAAGCTATATGGAGCTATATGTGCCTCGCCAGCAATCGCCCTTGAACCACATGGC
CTGCTGAAGGGAAAGAAGGCTACATCCTTTCCTGGTATGTGGAACAAGCTCTCGGACCAA
AGCGAATGCAAGAACAGGGTTGTCGTTGATGGCAACCTAATCACCAGCCAAGGTCCAGGC
ACATCCATGGAGTTCTCTCTCGCCATCGTGGAGAAGCTGTTTGGTCGGGAGAGGGCCGTC
GAGCTCGCCAAAACCATGGTCTTCATGTGA

Protein

290 aa

>Os06t0531200-02 Hypothetical conserved gene.
AAICAAPAVALGSWGLLNGLKATCYPSFMDKLPSEVNAVESRVQIDGNCVTSRGPGTAME
YSVVLVEQLYGKEKADEVAGPMVMRPQHGVEFSLKELNSTSWNVGETPQILVPIANGTEE
MEATMIIDILRRAKANVVVASLEETLEIVASRKVKMVADVLLDDALKQQYDLILLPGGLG
GAQAYAKSDKLIGLIKKQAEANKLYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQ
SECKNRVVVDGNLITSQGPGTSMEFSLAIVEKLFGRERAVELAKTMVFM*

5'UTR

chr06:19827829..19827829 (- strand) : 1 bp

CDS

chr06:19827766..19827828 (- strand) : 63 bp

chr06:19827497..19827679 (- strand) : 183 bp

chr06:19826595..19826675 (- strand) : 81 bp

chr06:19825693..19825893 (- strand) : 201 bp

chr06:19825074..19825214 (- strand) : 141 bp

chr06:19824749..19824949 (- strand) : 201 bp

3'UTR

chr06:19824521..19824748 (- strand) : 228 bp

FASTA

>Os06t0531200-02 class=Sequence position=chr06:19824521..19827829 (- strand)
TGCTGCAATA TGTGCTGCAC CAGCTGTCGC TCTAGGATCA TGGGGTTTGC TGAATGGATT GAAGGTGGTC TTTTCATCAT
TAGTTGGCTC TTGCATACAC AATATTATTA CTTTTCAATT CTAAGAAGCT TGTTTTGCCT TTTGTGACAG GCAACTTGTT
ATCCTTCATT CATGGATAAA CTTCCTTCAG AGGTCAATGC TGTAGAATCG AGGGTGCAGA TTGATGGGAA CTGTGTGACC
AGTCGAGGAC CAGGAACGGC CATGGAGTAT TCTGTTGTTT TGGTCGAACA ATTATATGGC AAAGAAAAAG CTGATGAAGT
TGCTGGTCCA ATGGTAGGAA TCGTTTTGAA CATTGGATTG CATACAGTTG TTAGGAATGC GTTTTCTTAT ATTTCCATTG
CAGAAAGGCA TTTGAAAAGA ATAATTTGGA GGTAAATATT TGCATTCTGC ATTTTAGAGA AAACTTTACT CTGTGGTTTC
TTATTTGAAG TTTATTAGAC TGCTGTTTAG CGTAGAAGTG TAGTGTGCCT GCTTTGACTA ATAATTTGAA GTGTGGATAT
TGCACGGATG ACATTCGTGT TCATCATCTT ATGTGCTAAT TTATGCTTCA TCATGCAGAA TTAATTGAAA TACATTTACC
TTGTCATGCA TGAGAAACCA TTTGCATCAA ATCTTAAATC GCAGACTTTT CCATGCAACT TCATTCTACT TTTGTTTGAT
ATCATTCTTG AGATGAAGAT TTTAACTCAT TAGTATTTTT TGATGTGGTG AATCATGATG AAATTTCTAT CTTCTAACTT
GAGGTATTAT AGTTTATGCT AAAACTAGAA AACATTCTAT TTGAAACTAT GGCCATTTTG GGATATGTAG AATCTAATTG
GCCTTAAAAA GCCTTTGCTC CCTGCCATCT TATTCCTAGT CAAAACTGGC TATAGTTGCA TTTGAAATTT CTTCAATGTG
TTGTTTTTAT AAAATTCGTA CATTGAAGTA CTTTTTTCAC ACATGGACTG CAAAGGTTAA TTTCGATTGA GTAGCTTTTC
TCTATGATAC TTGTACTGCT GTTTTGTTTT TTCGGGTTTG TAATTTTTTC AGTAGTGTTT ACATATTTTC CACAGCTGAT
GCTTGCATTT AATTTAGTGC TTACATCTTT TAAGGTCATG CGCCCCCAGC ATGGTGTGGA GTTCTCATTG AAAGAGTTGA
ATTCAACTAG TTGGAATGTT GGTGAAACAC CTCAGGTATT CAAAGTTCAG TATGGAAACT ACTTGTTACA TGTAGCACTC
ATTTTCTTTT GTTTCATGGC AATGTATACA CTATATAAAA TTTTATGTTG CCTGGAGTAA CAATTTGTAG TCTGCTATGT
TTGGTGAAAA TGGGCAAGTT TTCTAGTAAA GCTTCCTAAA TACCAAGAGG TAGGATAAGG CAGTATATGG TAAACTGTGT
AATTTAATGA CAAGAGAAGG GAAGTCATCT TGAAATGGCA AAACCTCTTC ATAACTCTTT TCATTCACTG CGTTCTTAGT
GATGCTAAAT CCCTAGATTT GATAGATTTA AGATGAGGGC TGGGTAGTGA TGCATGTAGT TTGTCGGTTA CTTTCAAGAG
TTTGTTGGAT GAAATATAGT ATGTCTAGCT GGATTAATAA TATGATAGGA GGGATGTGAG TTGGGATTTA TGTTTGTTAA
GGATTTAGCA CATGATTAAA GATAAATCCT AGTAGCTACT GTCAAGGAAT TAAAATGCTC TTTTGTGGAC CATCAATCGA
TTGAAGTTAT TTTGCAGGTT TGATGTTACA TGTGATTATT TAGGTGAACT TACGCTTGTT GCTTCTCTGC TTTCTATCAT
TTTTGTCATT GGCTTAAACA TGGAGTAACA GCTTACATGT TCAAACTATG TGTTGCTGCT TGGTTTCACC AGCAAGATCT
TGTTCTTGTG CTGCAGATTC TTGTACCAAT TGCTAATGGG ACAGAGGAGA TGGAAGCAAC TATGATAATC GACATCCTCA
GAAGGGCGAA AGCAAATGTT GTCGTTGCGT CCTTGGAGGA AACTTTGGAG ATTGTTGCAT CCAGGAAAGT GAAGATGGTT
GCTGATGTTC TGTTGGATGA TGCTCTTAAG CAGCAATATG ATCTCATTTT GTTACCAGTA AGTTTAGTGA ATCAATGGGT
ATTTCAATTT TGACCTTAAC TAAATAACAG ATATTTGCAC CCCCCCCCCC AAAAAAAAAA AAAATTCTGA AAGCAGACAG
AGAAAACACT CCACCCTATT CCATTGTGGA TTTGGTTAAT ATGGTGGTAG TTTTTGCTGA TTTGAACTAT TAGTTGAGTT
TCATTGATGT GTACTCAACC ACGTGGTGTC TACAGTTCTA CACCAACAAA ACATGTATCC ATATATGTCT AAATTTGCAA
AAACCACTGC CATATTAATT ATAAGGTGAT GGAATATGGT TCAAGGTGTT TGTCTCGTTT GGAATTTAAG AGCGAAAACA
ACTGTTTTTT GAATGTTAAG GTGAAAAATG GACTTCAAGA AGTATTTCAA GGGAACGTTG GACTTTAGAT TAATTTAATG
TCTAATAATT TATAATCTAG CTTGCTGGTT AAATGACCTT CCATGTTTTC TGTAGGGTGG TCTTGGTGGT GCCCAAGCAT
ATGCAAAGTC AGATAAACTG ATTGGTCTGA TCAAGAAGCA AGCTGAGGCA AACAAGCTAT ATGGAGCTAT ATGTGCCTCG
CCAGCAATCG CCCTTGAACC ACATGGCCTG CTGAAGGTAT ATACAGCTGT CTATCATGCG ATGAACATAA ATCCTTGTGG
TGCAAACATG CAGAAACACC TGTTCTTTTA CTGGGAAGAC AAATCTTTTT TGACTGGTAT GTAACATGTT TTTGCATCAG
GGAAAGAAGG CTACATCCTT TCCTGGTATG TGGAACAAGC TCTCGGACCA AAGCGAATGC AAGAACAGGG TTGTCGTTGA
TGGCAACCTA ATCACCAGCC AAGGTCCAGG CACATCCATG GAGTTCTCTC TCGCCATCGT GGAGAAGCTG TTTGGTCGGG
AGAGGGCCGT CGAGCTCGCC AAAACCATGG TCTTCATGTG AGTTGTGTTG TTACATACTA CGTGTAAGAC AACACCATAG
TCAGACTCTG AATATGAGGC ATCCTTTTGC TCGTAGCTGG TGTGGTGGAA AGCACTTCGT AATCCTTTTT TTTGGCTTTC
TCTTCCACAA TAACACGACG TCTTGTTATG TGTACAACCG TACAAATGCA ATAAAAAGAG ATGGATATTG CACCTTTGGG
TTGGGGGGGG GGGGTATATG ATGATGGTA

Locus: Os06g0531200

Loading...

Locus: Os06g0531200

Loading...