Os06t0536000-00

Locus

Os06g0536000

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCAF1-9, OsCAF1J

Oryzabase Gene Name Synonym(s)

CCR4-associated factor 1-9, carbon catabolite repressor 4-associated factor 1-9, CCR4-associated factor 1J, carbon catabolite repressor 4-associated factor 1J

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os06t0536000-00)

Others

Oryzabase (18268)

Transcript

822 bp

>Os06t0536000-00
ATGGCCGCTGCCGTCCGGTCCGTGTGGGCGGACAACTTCGCCGCCGAGTCGGCCATCCTC
CGCGCCGTCGCGCCATGCGCCGTCTACGCCGCCATTAACGTCCAGTATCCAGGCTGCGTC
GTTTCCGCCGCTGGCGGCGCCGGCGACCACCGCTGCTACTACGACCTCACCGCCGAGGAG
CGGTACCAGGTGGTGAGGGCGAACGCGGACGAGCTCAAGCCCCTCCAGCTCGGCCTCGCC
GTGCGCACCGCCGACGGCGGCCGCTTCGCCTGGGAGTTCAACCTGAACGAGTTCGACCTC
GCCGCCGACGGCGACATGTGCGAGCCGGGCTCCGTCGACTACCTCCGCCACCGCGGCATG
GACTTCAACGCCCTCCCATGGTCGGGCGTCGGCGCCGCCAGCCTCGGCCGCCTGCTCTGG
AGCTCCGGCCTCCTCGCCGCGCGGCCGTCGTGGGCCACCTTCGCCGGGGCCTACCACGTC
GCCTACTTCGCCAGGATCTTGATGCTCGCCGTCGCCGTCGCCGGCACCGGCGGCGGCGGG
GCGGCGAGGCGGCTCCCCGCCGACGTCGGGGGATTCGAGGAGATGGTCCGCTCGCTGCTG
GGGCATCACGTGTACGACGTCAGGTTGCTGGCCGGGGAGCTCAGGGGCCCGCTCGCCGAC
GTTGCGAGGCAGCTCGGCGCCGCTGTCCCAGCCGACGCGGCCGCCGCGGGGCTCGCCGGC
GCCGGCGCCCTCATGGCGCTGCAGGCTTTCGAAGCCCTGAGGGAGCAATGCCGCGGCGTG
ATGCCTCATCGTGGATTGCTATGTGGGATTCAAGCAAGCTAG

CDS

822 bp

>Os06t0536000-00
ATGGCCGCTGCCGTCCGGTCCGTGTGGGCGGACAACTTCGCCGCCGAGTCGGCCATCCTC
CGCGCCGTCGCGCCATGCGCCGTCTACGCCGCCATTAACGTCCAGTATCCAGGCTGCGTC
GTTTCCGCCGCTGGCGGCGCCGGCGACCACCGCTGCTACTACGACCTCACCGCCGAGGAG
CGGTACCAGGTGGTGAGGGCGAACGCGGACGAGCTCAAGCCCCTCCAGCTCGGCCTCGCC
GTGCGCACCGCCGACGGCGGCCGCTTCGCCTGGGAGTTCAACCTGAACGAGTTCGACCTC
GCCGCCGACGGCGACATGTGCGAGCCGGGCTCCGTCGACTACCTCCGCCACCGCGGCATG
GACTTCAACGCCCTCCCATGGTCGGGCGTCGGCGCCGCCAGCCTCGGCCGCCTGCTCTGG
AGCTCCGGCCTCCTCGCCGCGCGGCCGTCGTGGGCCACCTTCGCCGGGGCCTACCACGTC
GCCTACTTCGCCAGGATCTTGATGCTCGCCGTCGCCGTCGCCGGCACCGGCGGCGGCGGG
GCGGCGAGGCGGCTCCCCGCCGACGTCGGGGGATTCGAGGAGATGGTCCGCTCGCTGCTG
GGGCATCACGTGTACGACGTCAGGTTGCTGGCCGGGGAGCTCAGGGGCCCGCTCGCCGAC
GTTGCGAGGCAGCTCGGCGCCGCTGTCCCAGCCGACGCGGCCGCCGCGGGGCTCGCCGGC
GCCGGCGCCCTCATGGCGCTGCAGGCTTTCGAAGCCCTGAGGGAGCAATGCCGCGGCGTG
ATGCCTCATCGTGGATTGCTATGTGGGATTCAAGCAAGCTAG

Protein

274 aa

>Os06t0536000-00
MAAAVRSVWADNFAAESAILRAVAPCAVYAAINVQYPGCVVSAAGGAGDHRCYYDLTAEE
RYQVVRANADELKPLQLGLAVRTADGGRFAWEFNLNEFDLAADGDMCEPGSVDYLRHRGM
DFNALPWSGVGAASLGRLLWSSGLLAARPSWATFAGAYHVAYFARILMLAVAVAGTGGGG
AARRLPADVGGFEEMVRSLLGHHVYDVRLLAGELRGPLADVARQLGAAVPADAAAAGLAG
AGALMALQAFEALREQCRGVMPHRGLLCGIQAS*

CDS

chr06:20085771..20086592 (+ strand) : 822 bp

FASTA

>Os06t0536000-00 class=Sequence position=chr06:20085771..20086592 (+ strand)
ATGGCCGCTG CCGTCCGGTC CGTGTGGGCG GACAACTTCG CCGCCGAGTC GGCCATCCTC CGCGCCGTCG CGCCATGCGC
CGTCTACGCC GCCATTAACG TCCAGTATCC AGGCTGCGTC GTTTCCGCCG CTGGCGGCGC CGGCGACCAC CGCTGCTACT
ACGACCTCAC CGCCGAGGAG CGGTACCAGG TGGTGAGGGC GAACGCGGAC GAGCTCAAGC CCCTCCAGCT CGGCCTCGCC
GTGCGCACCG CCGACGGCGG CCGCTTCGCC TGGGAGTTCA ACCTGAACGA GTTCGACCTC GCCGCCGACG GCGACATGTG
CGAGCCGGGC TCCGTCGACT ACCTCCGCCA CCGCGGCATG GACTTCAACG CCCTCCCATG GTCGGGCGTC GGCGCCGCCA
GCCTCGGCCG CCTGCTCTGG AGCTCCGGCC TCCTCGCCGC GCGGCCGTCG TGGGCCACCT TCGCCGGGGC CTACCACGTC
GCCTACTTCG CCAGGATCTT GATGCTCGCC GTCGCCGTCG CCGGCACCGG CGGCGGCGGG GCGGCGAGGC GGCTCCCCGC
CGACGTCGGG GGATTCGAGG AGATGGTCCG CTCGCTGCTG GGGCATCACG TGTACGACGT CAGGTTGCTG GCCGGGGAGC
TCAGGGGCCC GCTCGCCGAC GTTGCGAGGC AGCTCGGCGC CGCTGTCCCA GCCGACGCGG CCGCCGCGGG GCTCGCCGGC
GCCGGCGCCC TCATGGCGCT GCAGGCTTTC GAAGCCCTGA GGGAGCAATG CCGCGGCGTG ATGCCTCATC GTGGATTGCT
ATGTGGGATT CAAGCAAGCT AG

Locus: Os06g0536000

Loading...

Locus: Os06g0536000

Loading...