Os06t0539500-00

Locus

Os06g0539500

Description

Similar to Non-specific lipid-transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.6, OsLtpI.6

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.6, lipid transfer protein 1.6, type 1 non-specific lipid transfer protein 6

Transcript Evidence

BT066221 (DDBJ)

Protein Evidence

B9FTM6 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os06t0539500-00)

Others

Oryzabase (13515)

Transcript

377 bp

>Os06t0539500-00 Similar to Non-specific lipid-transfer protein.
ATGGGCAAGAACGCGAGCCGCCTCGCCGTCGCCGCCGTCGTCGTGTTCGCGCTGCTGCTG
TCGCTCCGGCAGCTGGAGGCGGCCGACGACGTCTCCGTGTCGTGCTCCGACGTGGTCGCC
GACGTGACGCCGTGCCTGGGGTTCCTGCAGGGAGACGACGACCACCCCTCCGGCGAGTGC
TGCGACGGCCTGTCCGGCCTGGTGGCCGCCGCGGCCACCACGGAGGACCGGCAGGCGGCG
TGCGAGTGCCTCAAGTCGGCCGTCTCCGGCCAGTTCACCGCCGTCGAGGCCGCGCCGGCG
AGGGACCTGCCGGCGGACTGCGGCCTCTCCCTGCCCTACACCTTCTCGCCGGACGTCGAC
TGCTCCCAGTAAGTACA

CDS

372 bp

>Os06t0539500-00 Similar to Non-specific lipid-transfer protein.
ATGGGCAAGAACGCGAGCCGCCTCGCCGTCGCCGCCGTCGTCGTGTTCGCGCTGCTGCTG
TCGCTCCGGCAGCTGGAGGCGGCCGACGACGTCTCCGTGTCGTGCTCCGACGTGGTCGCC
GACGTGACGCCGTGCCTGGGGTTCCTGCAGGGAGACGACGACCACCCCTCCGGCGAGTGC
TGCGACGGCCTGTCCGGCCTGGTGGCCGCCGCGGCCACCACGGAGGACCGGCAGGCGGCG
TGCGAGTGCCTCAAGTCGGCCGTCTCCGGCCAGTTCACCGCCGTCGAGGCCGCGCCGGCG
AGGGACCTGCCGGCGGACTGCGGCCTCTCCCTGCCCTACACCTTCTCGCCGGACGTCGAC
TGCTCCCAGTAA

Protein

124 aa

>Os06t0539500-00 Similar to Non-specific lipid-transfer protein.
MGKNASRLAVAAVVVFALLLSLRQLEAADDVSVSCSDVVADVTPCLGFLQGDDDHPSGEC
CDGLSGLVAAAATTEDRQAACECLKSAVSGQFTAVEAAPARDLPADCGLSLPYTFSPDVD
CSQ*

CDS

chr06:20257255..20257626 (- strand) : 372 bp

3'UTR

chr06:20257250..20257254 (- strand) : 5 bp

FASTA

>Os06t0539500-00 class=Sequence position=chr06:20257250..20257626 (- strand)
ATGGGCAAGA ACGCGAGCCG CCTCGCCGTC GCCGCCGTCG TCGTGTTCGC GCTGCTGCTG TCGCTCCGGC AGCTGGAGGC
GGCCGACGAC GTCTCCGTGT CGTGCTCCGA CGTGGTCGCC GACGTGACGC CGTGCCTGGG GTTCCTGCAG GGAGACGACG
ACCACCCCTC CGGCGAGTGC TGCGACGGCC TGTCCGGCCT GGTGGCCGCC GCGGCCACCA CGGAGGACCG GCAGGCGGCG
TGCGAGTGCC TCAAGTCGGC CGTCTCCGGC CAGTTCACCG CCGTCGAGGC CGCGCCGGCG AGGGACCTGC CGGCGGACTG
CGGCCTCTCC CTGCCCTACA CCTTCTCGCC GGACGTCGAC TGCTCCCAGT AAGTACA

Locus: Os06g0539500

Loading...

Locus: Os06g0539500

Loading...