Os06t0554800-01

Locus

Os06g0554800

Description

Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR12

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 12

Oryzabase Gene Symbol Synonym(s)

OsABCG42, OsPDR12, OsABCG42_1, OsABCG42_2

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 42, pleiotropic drug resistance 12

Transcript Evidence

AK121182 (DDBJ, Best hit)

Protein Evidence

Q5Z9S8-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Full-length cDNA

J023084H11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0554800-01)

RiceXPro (AK121182)

Others

Oryzabase (12016)

KEGG (Os06t0554800-01)

Transcript

4315 bp

>Os06t0554800-01 Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).
AATCATATAGGACTTGGTTGCACATTTGTCCACAAGCAAACAACTAGTACTAACCATGAC
CCAGGTTGGTGAACACTGCACACCAAATGGGAAAAGGGGAATTTTTTTTTCTTTTTTTTT
TCAAGGATCCAATCAACCACCAAGTCCACTACTATGATTCTTGGGCACATACTTCTCCTA
CTGATTAGTAGCAGCAGCAGCAGCAGGCAGGAGGGAGTGGGTTTGTTTGCTGACTCTCTT
GTGTCTTGACCACAAAGGATGGTTCTTTCTTCCCTCTTCTTCTTCCTCCCTCCTCCTCAC
CTACTGCTAATTGGGAGATGGAGCTCGAATTGAGTTCTTGGTGGGGCATCCTTGTAGCTT
TGGGAGGGGGGATTGGGGGGTTGGTGCACCCACTTGGCCTGGTGGAAATGGCGCGCACCC
GTGGTGATGATGCCCACCACATGTTTGTTGATATGCCCAGCCAAAGCTTCTGCTTCTTAT
CAGCTTTACTGCGAGTTTCCGAGCACTGGCCACGTAGTAACATAATTACATTGGGCAGGA
TGGATGATACTGGGATTGGATATATGCGCGGACACGATCGTCGGCGACCAGATGCAGAGG
GGGATCTCCGGTGGTCAGAAGAAACGCGTCACCACCGGTGAGATGATTGTCGGTCCAACA
AAGGTTCTATTCATGGATGAGATATCAACTGGATTGGACAGCTCCACCACATTCCAGATT
GTCAAATGCCTTCAGCAAATCGTGCACTTGGGCGAGGCAACCATCCTCATGTCACTCCTA
CAACCAGCCCCTGAGACTTTTGAGCTATTCGATGACATTATCCTACTGTCAGAAGGCCAG
ATTGTTTATCAGGGACCCCGCGAATACGTCCTTGAGTTCTTTGAGTCATGCGGATTCCGC
TGCCCAGAGCGTAAGGGTACTGCAGACTTTCTTCAGGAGGTGACATCAAAGAAGGATCAG
GAGCAGTATTGGGCCGACAAGCATAGGCCATACAGATACATTTCAGTCTCAGAATTTGCA
CAGAGATTTAAAAGGTTCCATGTTGGGCTCCAACTTGAGAATCATCTCTCAGTCCCATTT
GATAAAACTCGTAGCCATCAGGCTGCTCTTGTCTTCTCGAAGCAATCGGTGTCAACAACA
GAGCTCCTCAAGGCATCCTTTGCCAAGGAGTGGCTCCTCATTAAGCGCAACTCATTTGTG
TACATCTTCAAGACCATACAGCTCATCATTGTAGCCCTTGTCGCGTCGACAGTGTTTCTT
AGGACCCAGATGCACACAAGGAATTTAGATGATGGCTTTGTGTACATTGGAGCACTACTT
TTCAGTCTGATTGTGAACATGTTCAATGGTTTCGCTGAGCTCTCTTTGACCATCACAAGG
TTGCCAGTGTTCTTCAAGCACCGGGACCTCCTCTTCTACCCTGCTTGGATCTTCACTCTA
CCGAATGTTATTCTGAGAATCCCATTTTCCATCATCGAATCTATAGTCTGGGTGATTGTT
ACATACTACACTATAGGATTTGCCCCAGAGGCTGACAGATTTTTCAAGCAGTTGCTGCTA
GTGTTCTTGATCCAGCAGATGGCAGGTGGCCTTTTCAGAGCAACTGCTGGTCTGTGCAGA
TCCATGATCATTGCTCAAACTGGAGGAGCCCTGGCCCTTCTCATATTTTTCGTTCTTGGA
GGATTTCTTCTGCCAAAAGCATTCATCCCAAAATGGTGGATCTGGGGTTACTGGGTTTCA
CCACTGATGTACGGGTATAATGCTCTAGCAGTCAATGAATTCTACTCTCCTCGGTGGATG
AACAAGTTTGTACTGGATAACAATGGCGTTCCTAAAAGACTAGGAATAGCTCTGATGGAA
GGTGCCAACATCTTCACTGACAAAAATTGGTTCTGGATTGGAGCAGCAGGGCTCCTGGGT
TTCACCATGTTTTTCAATGTGCTTTTCACTCTGTCACTCGTTTATCTGAATCCTCTGGGC
AAACCACAAGCTGTCATATCTGAAGAAACTGCGAAGGAAGCGGAAGGCAATGGGGATGCA
AGACATACAGTAAGAAATGGCAGCACAAAATCAAATGGTGGAAATCACAAAGAAATGAGG
GAGATGAGATTGAGTGCTCGTCTGAGCAATAGTTCATCGAATGGAGTTTCACGACTGATG
TCCATTGGTAGCAATGAAGCTGGTCCAAGAAGAGGAATGGTTCTTCCATTTACTCCTCTA
TCCATGTCTTTTGATGATGTGAACTACTATGTCGACATGCCTGCAGAAATGAAGCAGCAA
GGAGTGGTGGATGATAGGCTCCAATTGTTACGTGACGTTACTGGATCATTTAGGCCTGCA
GTGCTGACAGCACTCATGGGAGTCAGTGGAGCCGGAAAGACAACTCTTATGGATGTTTTG
GCAGGAAGAAAGACTGGTGGTTACATTGAAGGAGATATGAGAATTTCTGGTTATCCTAAG
AACCAAGAAACATTTGCAAGAATTTCTGGCTACTGTGAGCAAAACGATATCCATTCACCT
CAGGTCACAGTTAGGGAGTCTTTGATATACTCTGCTTTCCTGCGCCTTCCAGAAAAAATA
GGAGATCAAGAAATCACTGATGATATCAAGATTCAATTTGTTGATGAAGTTATGGAACTA
GTGGAGCTCGACAATCTGAAGGATGCGTTAGTTGGCCTGCCTGGAATCACAGGGCTTTCA
ACAGAGCAAAGGAAGAGATTGACAATAGCAGTGGAGCTTGTTGCAAATCCCTCGATCATC
TTCATGGATGAACCGACTTCAGGTCTTGATGCAAGAGCAGCAGCCATTGTTATGAGAACA
GTGAGGAACACAGTTGACACTGGACGGACAGTGGTTTGCACAATTCACCAGCCAAGCATT
GACATATTTGAGGCTTTTGATGAGCTGCTACTACTGAAAAGAGGAGGGCAGGTGATATAC
TCTGGGCAATTGGGTCGTAATTCCCAGAAAATGATTGAATATTTCGAGGCAATTCCTGGT
GTGCCTAAAATCAAAGATAAGTACAATCCAGCTACATGGATGCTTGAGGTCAGTTCAGTT
GCTGCGGAAGTACGCTTAAATATGGACTTTGCTGAGTACTATAAGACATCAGACCTGTAC
AAGCAAAACAAGGTATTGGTGAATCAGCTAAGTCAACCAGAGCCAGGAACATCAGATCTG
CATTTTCCTACAAAATACTCTCAATCCACCATAGGGCAATTTAGGGCCTGCCTCTGGAAG
CAATGGCTGACCTATTGGCGCAGCCCAGATTACAATCTTGTTAGATTTTCCTTCACTCTG
TTCACAGCCTTGCTACTCGGCACCATCTTTTGGAAGATCGGCACCAAGATGGGAAATGCC
AATTCTCTTAGAATGGTCATTGGAGCAATGTATACAGCAGTGATGTTTATCGGTATCAAC
AATTGTGCGACTGTGCAGCCAATCGTGTCGATTGAGAGAACAGTTTTCTACCGAGAGAGG
GCTGCTGGGATGTACTCTGCTATGCCCTATGCCATTGCTCAGGTTGTCATGGAGATACCC
TATGTGTTCGTCCAAACTGCATATTATACCCTCATTGTTTATGCCATGATGAGCTTCCAG
TGGACAGCAGCCAAGTTCTTCTGGTTCTTCTTCGTCTCCTACTTCTCATTTCTCTACTTC
ACCTACTATGGTATGATGACGGTGGCAATCTCACCAAACCATGAGGTTGCAGCCATCTTT
GCCGCGGCGTTCTATTCCTTGTTCAACCTATTCTCAGGATTCTTCATTCCGAGACCAAGG
ATTCCCAAATGGTGGATCTGGTACTACTGGCTTTGCCCATTGGCATGGACAGTGTATGGG
CTCATAGTGACACAGTATGGAGACCTAGAACAAATCATCTCAGTCCCTGGCCAATCCAAC
CAGACAATCAGCTACTATGTTACTCATCATTTTGGATATCACAGGAAATTTATGCCAGTT
GTTGCGCCGGTGCTCGTGCTCTTCGCTGTGTTTTTCGCGTTCATGTATGCCATTTGCATC
AAGAAGTTGAACTTCCAACATCGATAGGGGCATTGAAACAACAGGCAAAATCTGGTTGGA
AACTTTTTTTTGGTTTTGAACCAAATCTTCTTTTGTCCTTTCCCCACAGATAATATCTTC
TTTTATCCTCACATTTTTGTGGTCTATATATGCCATGTAAATATGCTGGTAGGTTTTCTG
TATTCCATACATCGCCAAATGTGGCGAGGTTTCATATGACCTTTTAGCTTTGGAAATGTA
AACTTTATAAGAGCATTGTTGTCAGAAATTTTGTTCGTGGCCTATTCTTCCATTG

CDS

3504 bp

>Os06t0554800-01 Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).
ATGATACTGGGATTGGATATATGCGCGGACACGATCGTCGGCGACCAGATGCAGAGGGGG
ATCTCCGGTGGTCAGAAGAAACGCGTCACCACCGGTGAGATGATTGTCGGTCCAACAAAG
GTTCTATTCATGGATGAGATATCAACTGGATTGGACAGCTCCACCACATTCCAGATTGTC
AAATGCCTTCAGCAAATCGTGCACTTGGGCGAGGCAACCATCCTCATGTCACTCCTACAA
CCAGCCCCTGAGACTTTTGAGCTATTCGATGACATTATCCTACTGTCAGAAGGCCAGATT
GTTTATCAGGGACCCCGCGAATACGTCCTTGAGTTCTTTGAGTCATGCGGATTCCGCTGC
CCAGAGCGTAAGGGTACTGCAGACTTTCTTCAGGAGGTGACATCAAAGAAGGATCAGGAG
CAGTATTGGGCCGACAAGCATAGGCCATACAGATACATTTCAGTCTCAGAATTTGCACAG
AGATTTAAAAGGTTCCATGTTGGGCTCCAACTTGAGAATCATCTCTCAGTCCCATTTGAT
AAAACTCGTAGCCATCAGGCTGCTCTTGTCTTCTCGAAGCAATCGGTGTCAACAACAGAG
CTCCTCAAGGCATCCTTTGCCAAGGAGTGGCTCCTCATTAAGCGCAACTCATTTGTGTAC
ATCTTCAAGACCATACAGCTCATCATTGTAGCCCTTGTCGCGTCGACAGTGTTTCTTAGG
ACCCAGATGCACACAAGGAATTTAGATGATGGCTTTGTGTACATTGGAGCACTACTTTTC
AGTCTGATTGTGAACATGTTCAATGGTTTCGCTGAGCTCTCTTTGACCATCACAAGGTTG
CCAGTGTTCTTCAAGCACCGGGACCTCCTCTTCTACCCTGCTTGGATCTTCACTCTACCG
AATGTTATTCTGAGAATCCCATTTTCCATCATCGAATCTATAGTCTGGGTGATTGTTACA
TACTACACTATAGGATTTGCCCCAGAGGCTGACAGATTTTTCAAGCAGTTGCTGCTAGTG
TTCTTGATCCAGCAGATGGCAGGTGGCCTTTTCAGAGCAACTGCTGGTCTGTGCAGATCC
ATGATCATTGCTCAAACTGGAGGAGCCCTGGCCCTTCTCATATTTTTCGTTCTTGGAGGA
TTTCTTCTGCCAAAAGCATTCATCCCAAAATGGTGGATCTGGGGTTACTGGGTTTCACCA
CTGATGTACGGGTATAATGCTCTAGCAGTCAATGAATTCTACTCTCCTCGGTGGATGAAC
AAGTTTGTACTGGATAACAATGGCGTTCCTAAAAGACTAGGAATAGCTCTGATGGAAGGT
GCCAACATCTTCACTGACAAAAATTGGTTCTGGATTGGAGCAGCAGGGCTCCTGGGTTTC
ACCATGTTTTTCAATGTGCTTTTCACTCTGTCACTCGTTTATCTGAATCCTCTGGGCAAA
CCACAAGCTGTCATATCTGAAGAAACTGCGAAGGAAGCGGAAGGCAATGGGGATGCAAGA
CATACAGTAAGAAATGGCAGCACAAAATCAAATGGTGGAAATCACAAAGAAATGAGGGAG
ATGAGATTGAGTGCTCGTCTGAGCAATAGTTCATCGAATGGAGTTTCACGACTGATGTCC
ATTGGTAGCAATGAAGCTGGTCCAAGAAGAGGAATGGTTCTTCCATTTACTCCTCTATCC
ATGTCTTTTGATGATGTGAACTACTATGTCGACATGCCTGCAGAAATGAAGCAGCAAGGA
GTGGTGGATGATAGGCTCCAATTGTTACGTGACGTTACTGGATCATTTAGGCCTGCAGTG
CTGACAGCACTCATGGGAGTCAGTGGAGCCGGAAAGACAACTCTTATGGATGTTTTGGCA
GGAAGAAAGACTGGTGGTTACATTGAAGGAGATATGAGAATTTCTGGTTATCCTAAGAAC
CAAGAAACATTTGCAAGAATTTCTGGCTACTGTGAGCAAAACGATATCCATTCACCTCAG
GTCACAGTTAGGGAGTCTTTGATATACTCTGCTTTCCTGCGCCTTCCAGAAAAAATAGGA
GATCAAGAAATCACTGATGATATCAAGATTCAATTTGTTGATGAAGTTATGGAACTAGTG
GAGCTCGACAATCTGAAGGATGCGTTAGTTGGCCTGCCTGGAATCACAGGGCTTTCAACA
GAGCAAAGGAAGAGATTGACAATAGCAGTGGAGCTTGTTGCAAATCCCTCGATCATCTTC
ATGGATGAACCGACTTCAGGTCTTGATGCAAGAGCAGCAGCCATTGTTATGAGAACAGTG
AGGAACACAGTTGACACTGGACGGACAGTGGTTTGCACAATTCACCAGCCAAGCATTGAC
ATATTTGAGGCTTTTGATGAGCTGCTACTACTGAAAAGAGGAGGGCAGGTGATATACTCT
GGGCAATTGGGTCGTAATTCCCAGAAAATGATTGAATATTTCGAGGCAATTCCTGGTGTG
CCTAAAATCAAAGATAAGTACAATCCAGCTACATGGATGCTTGAGGTCAGTTCAGTTGCT
GCGGAAGTACGCTTAAATATGGACTTTGCTGAGTACTATAAGACATCAGACCTGTACAAG
CAAAACAAGGTATTGGTGAATCAGCTAAGTCAACCAGAGCCAGGAACATCAGATCTGCAT
TTTCCTACAAAATACTCTCAATCCACCATAGGGCAATTTAGGGCCTGCCTCTGGAAGCAA
TGGCTGACCTATTGGCGCAGCCCAGATTACAATCTTGTTAGATTTTCCTTCACTCTGTTC
ACAGCCTTGCTACTCGGCACCATCTTTTGGAAGATCGGCACCAAGATGGGAAATGCCAAT
TCTCTTAGAATGGTCATTGGAGCAATGTATACAGCAGTGATGTTTATCGGTATCAACAAT
TGTGCGACTGTGCAGCCAATCGTGTCGATTGAGAGAACAGTTTTCTACCGAGAGAGGGCT
GCTGGGATGTACTCTGCTATGCCCTATGCCATTGCTCAGGTTGTCATGGAGATACCCTAT
GTGTTCGTCCAAACTGCATATTATACCCTCATTGTTTATGCCATGATGAGCTTCCAGTGG
ACAGCAGCCAAGTTCTTCTGGTTCTTCTTCGTCTCCTACTTCTCATTTCTCTACTTCACC
TACTATGGTATGATGACGGTGGCAATCTCACCAAACCATGAGGTTGCAGCCATCTTTGCC
GCGGCGTTCTATTCCTTGTTCAACCTATTCTCAGGATTCTTCATTCCGAGACCAAGGATT
CCCAAATGGTGGATCTGGTACTACTGGCTTTGCCCATTGGCATGGACAGTGTATGGGCTC
ATAGTGACACAGTATGGAGACCTAGAACAAATCATCTCAGTCCCTGGCCAATCCAACCAG
ACAATCAGCTACTATGTTACTCATCATTTTGGATATCACAGGAAATTTATGCCAGTTGTT
GCGCCGGTGCTCGTGCTCTTCGCTGTGTTTTTCGCGTTCATGTATGCCATTTGCATCAAG
AAGTTGAACTTCCAACATCGATAG

Protein

1167 aa

>Os06t0554800-01 Similar to ABC transporter (PDR5-like) isolog (PDR1 ABC transporter).
MILGLDICADTIVGDQMQRGISGGQKKRVTTGEMIVGPTKVLFMDEISTGLDSSTTFQIV
KCLQQIVHLGEATILMSLLQPAPETFELFDDIILLSEGQIVYQGPREYVLEFFESCGFRC
PERKGTADFLQEVTSKKDQEQYWADKHRPYRYISVSEFAQRFKRFHVGLQLENHLSVPFD
KTRSHQAALVFSKQSVSTTELLKASFAKEWLLIKRNSFVYIFKTIQLIIVALVASTVFLR
TQMHTRNLDDGFVYIGALLFSLIVNMFNGFAELSLTITRLPVFFKHRDLLFYPAWIFTLP
NVILRIPFSIIESIVWVIVTYYTIGFAPEADRFFKQLLLVFLIQQMAGGLFRATAGLCRS
MIIAQTGGALALLIFFVLGGFLLPKAFIPKWWIWGYWVSPLMYGYNALAVNEFYSPRWMN
KFVLDNNGVPKRLGIALMEGANIFTDKNWFWIGAAGLLGFTMFFNVLFTLSLVYLNPLGK
PQAVISEETAKEAEGNGDARHTVRNGSTKSNGGNHKEMREMRLSARLSNSSSNGVSRLMS
IGSNEAGPRRGMVLPFTPLSMSFDDVNYYVDMPAEMKQQGVVDDRLQLLRDVTGSFRPAV
LTALMGVSGAGKTTLMDVLAGRKTGGYIEGDMRISGYPKNQETFARISGYCEQNDIHSPQ
VTVRESLIYSAFLRLPEKIGDQEITDDIKIQFVDEVMELVELDNLKDALVGLPGITGLST
EQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSID
IFEAFDELLLLKRGGQVIYSGQLGRNSQKMIEYFEAIPGVPKIKDKYNPATWMLEVSSVA
AEVRLNMDFAEYYKTSDLYKQNKVLVNQLSQPEPGTSDLHFPTKYSQSTIGQFRACLWKQ
WLTYWRSPDYNLVRFSFTLFTALLLGTIFWKIGTKMGNANSLRMVIGAMYTAVMFIGINN
CATVQPIVSIERTVFYRERAAGMYSAMPYAIAQVVMEIPYVFVQTAYYTLIVYAMMSFQW
TAAKFFWFFFVSYFSFLYFTYYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRI
PKWWIWYYWLCPLAWTVYGLIVTQYGDLEQIISVPGQSNQTISYYVTHHFGYHRKFMPVV
APVLVLFAVFFAFMYAICIKKLNFQHR*

5'UTR

chr06:21120106..21120648 (- strand) : 543 bp

CDS

chr06:21120103..21120105 (- strand) : 3 bp

chr06:21119797..21119887 (- strand) : 91 bp

chr06:21118167..21118468 (- strand) : 302 bp

chr06:21117789..21118070 (- strand) : 282 bp

chr06:21117387..21117703 (- strand) : 317 bp

chr06:21117143..21117303 (- strand) : 161 bp

chr06:21116930..21117045 (- strand) : 116 bp

chr06:21116600..21116756 (- strand) : 157 bp

chr06:21116399..21116515 (- strand) : 117 bp

chr06:21116141..21116316 (- strand) : 176 bp

chr06:21115687..21116034 (- strand) : 348 bp

chr06:21115189..21115479 (- strand) : 291 bp

chr06:21115025..21115108 (- strand) : 84 bp

chr06:21114784..21114917 (- strand) : 134 bp

chr06:21114448..21114675 (- strand) : 228 bp

chr06:21114194..21114365 (- strand) : 172 bp

chr06:21113860..21114114 (- strand) : 255 bp

chr06:21113502..21113771 (- strand) : 270 bp

3'UTR

chr06:21113234..21113501 (- strand) : 268 bp

FASTA

>Os06t0554800-01 class=Sequence position=chr06:21113234..21120648 (- strand)
AATCATATAG GACTTGGTTG CACATTTGTC CACAAGCAAA CAACTAGTAC TAACCATGAC CCAGGTTGGT GAACACTGCA
CACCAAATGG GAAAAGGGGA ATTTTTTTTT CTTTTTTTTT TCAAGGATCC AATCAACCAC CAAGTCCACT ACTATGATTC
TTGGGCACAT ACTTCTCCTA CTGATTAGTA GCAGCAGCAG CAGCAGGCAG GAGGGAGTGG GTTTGTTTGC TGACTCTCTT
GTGTCTTGAC CACAAAGGAT GGTTCTTTCT TCCCTCTTCT TCTTCCTCCC TCCTCCTCAC CTACTGCTAA TTGGGAGATG
GAGCTCGAAT TGAGTTCTTG GTGGGGCATC CTTGTAGCTT TGGGAGGGGG GATTGGGGGG TTGGTGCACC CACTTGGCCT
GGTGGAAATG GCGCGCACCC GTGGTGATGA TGCCCACCAC ATGTTTGTTG ATATGCCCAG CCAAAGCTTC TGCTTCTTAT
CAGCTTTACT GCGAGTTTCC GAGCACTGGC CACGTAGTAA CATAATTACA TTGGGCAGGA TGGATGGTAG GTAAAGTTTG
AAATGTGTGT TTTTTTTTTT TTTTTGGGGA TGGGGGGGGG GGGCAGGTGA CAGTAGCTTT CAGGGGCATT AAGCCCATGC
TTGACATGGG GTTAGCAGGA ATTAGTCATG TTAATTTAAA CTGTCTTGAT CCCGACGGTT GCAAGTAGCA ACTGGAGCTG
GTGAAAATTA TTTCTTTTTG ACTGAATTTT CTTGGGAGCA GATACTGGGA TTGGATATAT GCGCGGACAC GATCGTCGGC
GACCAGATGC AGAGGGGGAT CTCCGGTGGT CAGAAGAAAC GCGTCACCAC CGGTAAGCTG CTTCCGTCAG CATTGTGTCA
TGCTCATTTC AGCCCATGAA AGGAGCTGCT GCTCTGTGCC TTTGTTCCTT TCTGGTTTAG GGGGTAGAAG GCACAGATGT
ACGAATTAAA CTAAATTTAA ACTTAGAAGG GCCTGAAAGG AACTTGCAAA TTTTTTTTTT AAGTCTTTCT AGAAGACTAT
GATGTGTAGG AGACAATGCA ATTCCGGTGT CTACATCTTG TGGTTCCTAC TGGAAAAAGG TGTGGTGATC ATGAGATATA
TGTGTGCCTC TGAGGTCCAC ACATGAAGAA GTGCATGACC ACTTGACTGG GGTGCATGCT GTATTGTACA GGCATCTTAT
GGTTAATGCA CTGCATAGTT GTTGGATGGT CACTTGTCCA GTGACCACTC TTATCCTCTG AGAGTGTGAG GAAGAGCTGT
AGCTTGTTCA TTCCGCATCC TATACTGTAG ACAGTACCGC ATTGTAGGTT ATTGGGTTCA GTGTGATACT GATAGCTATT
AGAATGAACC AAAAGTGCAT GGGGGCAGAG AGATATGACC GAGTAGTACT TACTTTTGGG ACTATTGCAT TATAGGAGGG
TTCAAGTTTT GCTGGATCCT GTTGTCATAC CGATTTTGGT TGGAAAAGCT ATTGCTAAGT GCTAAATACT ACGGATAAAA
ATGAATCATA CATGTTCAAA ACAGATTACT GTGCTTTTCT TTTCCATTAA ATACATTCAC TTAAGAACAG TTCTGTTGCT
GCCCTAAAAA AGAACATTTT TGCAACAAGA AACACTTGAA ATTCTTTACA TGGTTCCAAT TATAGTATTA GCTTCTAGAC
GTGTAACAAG TCTAATGCAT GAAGATATTG TGTTATGTTT GGTGCTTGCA ATCTAAATTA TCAGTTCTGG ATTGGCACCG
GCACGTTTCC ACTCCCGATA TTCCCCTAGG CAGATTCACC CCCATCCCCA CCATTGCCTT CTTTTAACAT GACTATACAT
AAAAATATTT TCATACTATA TTATTATTTT CTATTTCTCA TAAGTGTTTC ACACAAAAGA TATCGGTCAA AGATGGATTT
TAGAGACCAA ACCCTTCCAA AATGTCATAT ATTCTGGAAG AAAAGGTGTA CAATTTCTTT TGCATAATTA CATTATATGG
CTAAAATCTA GAATGCAATT ATTTTTCTTG TAAAAATATG TTAAGAAGTG AAAAGCACAA AAACTAGCAA TTCAACAAAT
GATCAGTATG AACTATAAAG TATTGAAGGT ATTGACCCTT TTTTTCCCCG AAAATTGTAA GGATGCTAAC AATGAACAAA
TTTGCTCATT TGGAATGCAG GTGAGATGAT TGTCGGTCCA ACAAAGGTTC TATTCATGGA TGAGATATCA ACTGGATTGG
ACAGCTCCAC CACATTCCAG ATTGTCAAAT GCCTTCAGCA AATCGTGCAC TTGGGCGAGG CAACCATCCT CATGTCACTC
CTACAACCAG CCCCTGAGAC TTTTGAGCTA TTCGATGACA TTATCCTACT GTCAGAAGGC CAGATTGTTT ATCAGGGACC
CCGCGAATAC GTCCTTGAGT TCTTTGAGTC ATGCGGATTC CGCTGCCCAG AGCGTAAGGG TACTGCAGAC TTTCTTCAGG
AGGTAACATC ATGCAGTTGT CTAATTATTA GAATCTATGT TTCTGAAAGC TTCAATATGT GAATTTACCT GAACAGCTTT
ATTTTGCCAA TTTTTCAGGT GACATCAAAG AAGGATCAGG AGCAGTATTG GGCCGACAAG CATAGGCCAT ACAGATACAT
TTCAGTCTCA GAATTTGCAC AGAGATTTAA AAGGTTCCAT GTTGGGCTCC AACTTGAGAA TCATCTCTCA GTCCCATTTG
ATAAAACTCG TAGCCATCAG GCTGCTCTTG TCTTCTCGAA GCAATCGGTG TCAACAACAG AGCTCCTCAA GGCATCCTTT
GCCAAGGAGT GGCTCCTCAT TAAGCGCAAC TCATTTGTGT ACATCTTCAA GACCATACAG GTGAGCAAAG TTTCCTGTTC
AGTCTTGCCA CTTCTCAAAA TACACAATGC AATCGACTGA CACCTTCTGC CGGTGAACTT TGAAGCTCAT CATTGTAGCC
CTTGTCGCGT CGACAGTGTT TCTTAGGACC CAGATGCACA CAAGGAATTT AGATGATGGC TTTGTGTACA TTGGAGCACT
ACTTTTCAGT CTGATTGTGA ACATGTTCAA TGGTTTCGCT GAGCTCTCTT TGACCATCAC AAGGTTGCCA GTGTTCTTCA
AGCACCGGGA CCTCCTCTTC TACCCTGCTT GGATCTTCAC TCTACCGAAT GTTATTCTGA GAATCCCATT TTCCATCATC
GAATCTATAG TCTGGGTGAT TGTTACATAC TACACTATAG GATTTGCCCC AGAGGCTGAC AGGTACACAA AAAGCAGAAA
AAGAATTAAA CATGAATTCA GGAAAGCAAG GTTTCTGTCC ACTTACCTAT CATCTTTCTG CACAGATTTT TCAAGCAGTT
GCTGCTAGTG TTCTTGATCC AGCAGATGGC AGGTGGCCTT TTCAGAGCAA CTGCTGGTCT GTGCAGATCC ATGATCATTG
CTCAAACTGG AGGAGCCCTG GCCCTTCTCA TATTTTTCGT TCTTGGAGGA TTTCTTCTGC CAAAAGGTTT TTTTTACTTA
TCTAATTATT TTCACTCCAC GTTTTTTCTG CACATAAATG TTGCAGCTCT ATTGAATATT ACTTTGCCCT TGACTGTTAA
CAGCATTCAT CCCAAAATGG TGGATCTGGG GTTACTGGGT TTCACCACTG ATGTACGGGT ATAATGCTCT AGCAGTCAAT
GAATTCTACT CTCCTCGGTG GATGAACAAG TTTGTACTGG TAAGCTCATT ATAGCACTGC CTTTTCACTT GTTTGCGTAT
AGAGGTTCTT TACAGTCCTT GAGGAAGTAT CACAAGGTAC AACAGAAAAG GCTTACCTTG TAGTACCGCC TCAAGAACCT
TAAAATCCCT TGCAAATATG TTTTCTGACA ATGTTTGCAT GCATCTTGAC AGGATAACAA TGGCGTTCCT AAAAGACTAG
GAATAGCTCT GATGGAAGGT GCCAACATCT TCACTGACAA AAATTGGTTC TGGATTGGAG CAGCAGGGCT CCTGGGTTTC
ACCATGTTTT TCAATGTGCT TTTCACTCTG TCACTCGTTT ATCTGAATCG TAAGTATCTG AATTAAAATC TAAATGCTTA
TGTGATTATA GTTATTGGAC CAATACGTGA TTTGCTGGTT CTTTGATTGT TAGCTCTGGG CAAACCACAA GCTGTCATAT
CTGAAGAAAC TGCGAAGGAA GCGGAAGGCA ATGGGGATGC AAGACATACA GTAAGAAATG GCAGCACAAA ATCAAATGGT
GGAAATCACA GTAAGAAACT CTTCAAGTCA TAATTAAATC TGAAAAAATT GGAAGTTTTT AAAACTGAGG AATAATAAGG
CAATTATTTC AGAAGAAATG AGGGAGATGA GATTGAGTGC TCGTCTGAGC AATAGTTCAT CGAATGGAGT TTCACGACTG
ATGTCCATTG GTAGCAATGA AGCTGGTCCA AGAAGAGGAA TGGTTCTTCC ATTTACTCCT CTATCCATGT CTTTTGATGA
TGTGAACTAC TATGTCGACA TGCCTGCAGT GAGTTTACCT ATGCTTAACT TCTCTTGGCA TCTTGTCCTG TTCCCTGTCG
TATCCTCAAT CGAAAATTTG TAATATTTGA TTGAGATTAA TGTTTTATAC ATAGGAAATG AAGCAGCAAG GAGTGGTGGA
TGATAGGCTC CAATTGTTAC GTGACGTTAC TGGATCATTT AGGCCTGCAG TGCTGACAGC ACTCATGGGA GTCAGTGGAG
CCGGAAAGAC AACTCTTATG GATGTTTTGG CAGGAAGAAA GACTGGTGGT TACATTGAAG GAGATATGAG AATTTCTGGT
TATCCTAAGA ACCAAGAAAC ATTTGCAAGA ATTTCTGGCT ACTGTGAGCA AAACGATATC CATTCACCTC AGGTCACAGT
TAGGGAGTCT TTGATATACT CTGCTTTCCT GCGCCTTCCA GAAAAAATAG GAGATCAAGA AATCACTGAT GATATCAAGA
TTGTAAGTCA TGTCTTTTTC CTTGTCAAAA CACTGCATCT TTTTTCATCA TCAGGGTGTA TTATAAGTCA TTTACTTTTG
TTTGTTGCTA ACACAAAACA TTATTGTCAA TCAGGTGTTT TAATTTTTTG TGAATATTGG GTGGTTAATT TCTGATTACT
AGGATTTGTC GTCACAATTT GTCAAACTCA CAAGTTCAAT TGTTTCCAGC AATTTGTTGA TGAAGTTATG GAACTAGTGG
AGCTCGACAA TCTGAAGGAT GCGTTAGTTG GCCTGCCTGG AATCACAGGG CTTTCAACAG AGCAAAGGAA GAGATTGACA
ATAGCAGTGG AGCTTGTTGC AAATCCCTCG ATCATCTTCA TGGATGAACC GACTTCAGGT CTTGATGCAA GAGCAGCAGC
CATTGTTATG AGAACAGTGA GGAACACAGT TGACACTGGA CGGACAGTGG TTTGCACAAT TCACCAGCCA AGCATTGACA
TATTTGAGGC TTTTGATGAG GTGACTATGA ATAGTTTACT TACATAGTAA TTCCACCTTT TAGTAACTAA ATAGTAACTC
GAGCTTGAAC TCTCGTGCAG CTGCTACTAC TGAAAAGAGG AGGGCAGGTG ATATACTCTG GGCAATTGGG TCGTAATTCC
CAGAAAATGA TTGAATATTT CGAGGTACAG ATAGTTTCAG ATGGTGGTTA ACTTTTGCTA AGTGGAAGGT GTGTTATGAA
TAACTAGAAT AAATTTACTT TTCTAACCAA TCTGCTATTT AATATTACCA GGCAATTCCT GGTGTGCCTA AAATCAAAGA
TAAGTACAAT CCAGCTACAT GGATGCTTGA GGTCAGTTCA GTTGCTGCGG AAGTACGCTT AAATATGGAC TTTGCTGAGT
ACTATAAGAC ATCAGACCTG TACAAGTAAG CGAAACATTT TTTTTTCTTC TACTTTTAAA CTCTTATCTT TCTTCTTAAA
GTTTTTAGTT GTTGTGTGTC AATTCTCATG GAATAGATGG GCCGTGTTTT CAGGCAAAAC AAGGTATTGG TGAATCAGCT
AAGTCAACCA GAGCCAGGAA CATCAGATCT GCATTTTCCT ACAAAATACT CTCAATCCAC CATAGGGCAA TTTAGGGCCT
GCCTCTGGAA GCAATGGCTG ACCTATTGGC GCAGCCCAGA TTACAATCTT GTTAGATTTT CCTTCACTCT GTTCACAGCC
TTGCTACTCG GCACCATCTT TTGGAAGATC GGCACCAAGA TGTAAATACT TCCTCTCTTT TTCATCTTTG ACTCCTTAAT
CTTAATGTTC CAGTATCTGA CGTTTTTGGT GTCTTATGAT CAGGGGAAAT GCCAATTCTC TTAGAATGGT CATTGGAGCA
ATGTATACAG CAGTGATGTT TATCGGTATC AACAATTGTG CGACTGTGCA GCCAATCGTG TCGATTGAGA GAACAGTTTT
CTACCGAGAG AGGGCTGCTG GGATGTACTC TGCTATGCCC TATGCCATTG CTCAGGTAAC TTATGGTGGT AGCTAAGGCA
GTTAAGGTAT AATTTGTTTC CAGGAGTTGC TCAACTCTTG ATAATTTGTT GTAGGTTGTC ATGGAGATAC CCTATGTGTT
CGTCCAAACT GCATATTATA CCCTCATTGT TTATGCCATG ATGAGCTTCC AGTGGACAGC AGCCAAGTTC TTCTGGTTCT
TCTTCGTCTC CTACTTCTCA TTTCTCTACT TCACCTACTA TGGTATGATG ACGGTGGCAA TCTCACCAAA CCATGAGGTT
GCAGCCATCT TTGCCGCGGC GTTCTATTCC TTGTTCAACC TATTCTCAGG ATTCTTCATT CCGAGACCAG TGAGTTTTCT
TGGATCAAAC CGTTTCTTTG AACTTTTTAT TCTTCTTGGA AGATCAAAGT AATGGTGTTA TTCATGTTTT ATTTCAGAGG
ATTCCCAAAT GGTGGATCTG GTACTACTGG CTTTGCCCAT TGGCATGGAC AGTGTATGGG CTCATAGTGA CACAGTATGG
AGACCTAGAA CAAATCATCT CAGTCCCTGG CCAATCCAAC CAGACAATCA GCTACTATGT TACTCATCAT TTTGGATATC
ACAGGAAATT TATGCCAGTT GTTGCGCCGG TGCTCGTGCT CTTCGCTGTG TTTTTCGCGT TCATGTATGC CATTTGCATC
AAGAAGTTGA ACTTCCAACA TCGATAGGGG CATTGAAACA ACAGGCAAAA TCTGGTTGGA AACTTTTTTT TGGTTTTGAA
CCAAATCTTC TTTTGTCCTT TCCCCACAGA TAATATCTTC TTTTATCCTC ACATTTTTGT GGTCTATATA TGCCATGTAA
ATATGCTGGT AGGTTTTCTG TATTCCATAC ATCGCCAAAT GTGGCGAGGT TTCATATGAC CTTTTAGCTT TGGAAATGTA
AACTTTATAA GAGCATTGTT GTCAGAAATT TTGTTCGTGG CCTATTCTTC CATTG

Locus: Os06g0554800

Loading...

Locus: Os06g0554800

Loading...