Os06t0554800-02

Locus

Os06g0554800

Description

Similar to Isoform 2 of Pleiotropic drug resistance protein 12.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR12

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 12

Oryzabase Gene Symbol Synonym(s)

OsABCG42, OsPDR12, OsABCG42_1, OsABCG42_2

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 42, pleiotropic drug resistance 12

Transcript Evidence

AK058448 (DDBJ, Best hit)

Protein Evidence

B9FTR2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

ABC-2 type transporter (IPR013525)

Full-length cDNA

001-015-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0554800-02)

RiceXPro (AK058448)

Others

Oryzabase (12016)

KEGG (Os06t0554800-02)

Transcript

1368 bp

>Os06t0554800-02 Similar to Isoform 2 of Pleiotropic drug resistance protein 12.
AAAGAGGAGGGCAGGTGATATACTCTGGGCAATTGGGTCGTAATTCCCAGAAAATGATTG
AATATTTCGAGGCAATTCCTGGTGTGCCTAAAATCAAAGATAAGTACAATCCAGCTACAT
GGATGCTTGAGGTCAGTTCAGTTGCTGCGGAAGTACGCTTAAATATGGACTTTGCTGAGT
ACTATAAGACATCAGACCTGTACAAGCAAAACAAGGTATTGGTGAATCAGCTAAGTCAAC
CAGAGCCAGGAACATCAGATCTGCATTTTCCTACAAAATACTCTCAATCCACCATAGGGC
AATTTAGGGCCTGCCTCTGGAAGCAATGGCTGACCTATTGGCGCAGCCCAGATTACAATC
TTGTTAGATTTTCCTTCACTCTGTTCACAGCCTTGCTACTCGGCACCATCTTTTGGAAGA
TCGGCACCAAGATGGGAAATGCCAATTCTCTTAGAATGGTCATTGGAGCAATGTATACAG
CAGTGATGTTTATCGGTATCAACAATTGTGCGACTGTGCAGCCAATCGTGTCGATTGAGA
GAACAGTTTTCTACCGAGAGAGGGCTGCTGGGATGTACTCTGCTATGCCCTATGCCATTG
CTCAGGTTGTCATGGAGATACCCTATGTGTTCGTCCAAACTGCATATTATACCCTCATTG
TTTATGCCATGATGAGCTTCCAGTGGACAGCAGCCAAGTTCTTCTGGTTCTTCTTCGTCT
CCTACTTCTCATTTCTCTACTTCACCTACTATGGTATGATGACGGTGGCAATCTCACCAA
ACCATGAGGTTGCAGCCATCTTTGCCGCGGCGTTCTATTCCTTGTTCAACCTATTCTCAG
GATTCTTCATTCCGAGACCAAGGATTCCCAAATGGTGGATCTGGTACTACTGGCTTTGCC
CATTGGCATGGACAGTGTATGGGCTCATAGTGACACAGTATGGAGACCTAGAACAAATCA
TCTCAGTCCCTGGCCAATCCAACCAGACAATCAGCTACTATGTTACTCATCATTTTGGAT
ATCACAGGAAATTTATGCCAGTTGTTGCGCCGGTGCTCGTGCTCTTCGCTGTGTTTTTCG
CGTTCATGTATGCCATTTGCATCAAGAAGTTGAACTTCCAACATCGATAGGGGCATTGAA
ACAACAGGCAAAATCTGGTTGGAAACTTTTTTTTGGTTTTGAACCAAATCTTCTTTTGTC
CTTTCCCCACAGATAATATCTTCTTTTATCCTCACATTTTTGTGGTCTATATATGCCATG
TAAATATGCTGGTAGGTTTTCTGTATTCCATACATCGCCAAATGTGGCGAGGTTTCATAT
GACCTTTTAGCTTTGGAAATGTAAACTTTATAAGAGCATTGTTGTCAG

CDS

1128 bp

>Os06t0554800-02 Similar to Isoform 2 of Pleiotropic drug resistance protein 12.
AGAGGAGGGCAGGTGATATACTCTGGGCAATTGGGTCGTAATTCCCAGAAAATGATTGAA
TATTTCGAGGCAATTCCTGGTGTGCCTAAAATCAAAGATAAGTACAATCCAGCTACATGG
ATGCTTGAGGTCAGTTCAGTTGCTGCGGAAGTACGCTTAAATATGGACTTTGCTGAGTAC
TATAAGACATCAGACCTGTACAAGCAAAACAAGGTATTGGTGAATCAGCTAAGTCAACCA
GAGCCAGGAACATCAGATCTGCATTTTCCTACAAAATACTCTCAATCCACCATAGGGCAA
TTTAGGGCCTGCCTCTGGAAGCAATGGCTGACCTATTGGCGCAGCCCAGATTACAATCTT
GTTAGATTTTCCTTCACTCTGTTCACAGCCTTGCTACTCGGCACCATCTTTTGGAAGATC
GGCACCAAGATGGGAAATGCCAATTCTCTTAGAATGGTCATTGGAGCAATGTATACAGCA
GTGATGTTTATCGGTATCAACAATTGTGCGACTGTGCAGCCAATCGTGTCGATTGAGAGA
ACAGTTTTCTACCGAGAGAGGGCTGCTGGGATGTACTCTGCTATGCCCTATGCCATTGCT
CAGGTTGTCATGGAGATACCCTATGTGTTCGTCCAAACTGCATATTATACCCTCATTGTT
TATGCCATGATGAGCTTCCAGTGGACAGCAGCCAAGTTCTTCTGGTTCTTCTTCGTCTCC
TACTTCTCATTTCTCTACTTCACCTACTATGGTATGATGACGGTGGCAATCTCACCAAAC
CATGAGGTTGCAGCCATCTTTGCCGCGGCGTTCTATTCCTTGTTCAACCTATTCTCAGGA
TTCTTCATTCCGAGACCAAGGATTCCCAAATGGTGGATCTGGTACTACTGGCTTTGCCCA
TTGGCATGGACAGTGTATGGGCTCATAGTGACACAGTATGGAGACCTAGAACAAATCATC
TCAGTCCCTGGCCAATCCAACCAGACAATCAGCTACTATGTTACTCATCATTTTGGATAT
CACAGGAAATTTATGCCAGTTGTTGCGCCGGTGCTCGTGCTCTTCGCTGTGTTTTTCGCG
TTCATGTATGCCATTTGCATCAAGAAGTTGAACTTCCAACATCGATAG

Protein

375 aa

>Os06t0554800-02 Similar to Isoform 2 of Pleiotropic drug resistance protein 12.
RGGQVIYSGQLGRNSQKMIEYFEAIPGVPKIKDKYNPATWMLEVSSVAAEVRLNMDFAEY
YKTSDLYKQNKVLVNQLSQPEPGTSDLHFPTKYSQSTIGQFRACLWKQWLTYWRSPDYNL
VRFSFTLFTALLLGTIFWKIGTKMGNANSLRMVIGAMYTAVMFIGINNCATVQPIVSIER
TVFYRERAAGMYSAMPYAIAQVVMEIPYVFVQTAYYTLIVYAMMSFQWTAAKFFWFFFVS
YFSFLYFTYYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKWWIWYYWLCP
LAWTVYGLIVTQYGDLEQIISVPGQSNQTISYYVTHHFGYHRKFMPVVAPVLVLFAVFFA
FMYAICIKKLNFQHR*

5'UTR

chr06:21115094..21115095 (- strand) : 2 bp

CDS

chr06:21115025..21115093 (- strand) : 69 bp

chr06:21114784..21114917 (- strand) : 134 bp

chr06:21114448..21114675 (- strand) : 228 bp

chr06:21114194..21114365 (- strand) : 172 bp

chr06:21113860..21114114 (- strand) : 255 bp

chr06:21113502..21113771 (- strand) : 270 bp

3'UTR

chr06:21113264..21113501 (- strand) : 238 bp

FASTA

>Os06t0554800-02 class=Sequence position=chr06:21113264..21115095 (- strand)
AAAGAGGAGG GCAGGTGATA TACTCTGGGC AATTGGGTCG TAATTCCCAG AAAATGATTG AATATTTCGA GGTACAGATA
GTTTCAGATG GTGGTTAACT TTTGCTAAGT GGAAGGTGTG TTATGAATAA CTAGAATAAA TTTACTTTTC TAACCAATCT
GCTATTTAAT ATTACCAGGC AATTCCTGGT GTGCCTAAAA TCAAAGATAA GTACAATCCA GCTACATGGA TGCTTGAGGT
CAGTTCAGTT GCTGCGGAAG TACGCTTAAA TATGGACTTT GCTGAGTACT ATAAGACATC AGACCTGTAC AAGTAAGCGA
AACATTTTTT TTTCTTCTAC TTTTAAACTC TTATCTTTCT TCTTAAAGTT TTTAGTTGTT GTGTGTCAAT TCTCATGGAA
TAGATGGGCC GTGTTTTCAG GCAAAACAAG GTATTGGTGA ATCAGCTAAG TCAACCAGAG CCAGGAACAT CAGATCTGCA
TTTTCCTACA AAATACTCTC AATCCACCAT AGGGCAATTT AGGGCCTGCC TCTGGAAGCA ATGGCTGACC TATTGGCGCA
GCCCAGATTA CAATCTTGTT AGATTTTCCT TCACTCTGTT CACAGCCTTG CTACTCGGCA CCATCTTTTG GAAGATCGGC
ACCAAGATGT AAATACTTCC TCTCTTTTTC ATCTTTGACT CCTTAATCTT AATGTTCCAG TATCTGACGT TTTTGGTGTC
TTATGATCAG GGGAAATGCC AATTCTCTTA GAATGGTCAT TGGAGCAATG TATACAGCAG TGATGTTTAT CGGTATCAAC
AATTGTGCGA CTGTGCAGCC AATCGTGTCG ATTGAGAGAA CAGTTTTCTA CCGAGAGAGG GCTGCTGGGA TGTACTCTGC
TATGCCCTAT GCCATTGCTC AGGTAACTTA TGGTGGTAGC TAAGGCAGTT AAGGTATAAT TTGTTTCCAG GAGTTGCTCA
ACTCTTGATA ATTTGTTGTA GGTTGTCATG GAGATACCCT ATGTGTTCGT CCAAACTGCA TATTATACCC TCATTGTTTA
TGCCATGATG AGCTTCCAGT GGACAGCAGC CAAGTTCTTC TGGTTCTTCT TCGTCTCCTA CTTCTCATTT CTCTACTTCA
CCTACTATGG TATGATGACG GTGGCAATCT CACCAAACCA TGAGGTTGCA GCCATCTTTG CCGCGGCGTT CTATTCCTTG
TTCAACCTAT TCTCAGGATT CTTCATTCCG AGACCAGTGA GTTTTCTTGG ATCAAACCGT TTCTTTGAAC TTTTTATTCT
TCTTGGAAGA TCAAAGTAAT GGTGTTATTC ATGTTTTATT TCAGAGGATT CCCAAATGGT GGATCTGGTA CTACTGGCTT
TGCCCATTGG CATGGACAGT GTATGGGCTC ATAGTGACAC AGTATGGAGA CCTAGAACAA ATCATCTCAG TCCCTGGCCA
ATCCAACCAG ACAATCAGCT ACTATGTTAC TCATCATTTT GGATATCACA GGAAATTTAT GCCAGTTGTT GCGCCGGTGC
TCGTGCTCTT CGCTGTGTTT TTCGCGTTCA TGTATGCCAT TTGCATCAAG AAGTTGAACT TCCAACATCG ATAGGGGCAT
TGAAACAACA GGCAAAATCT GGTTGGAAAC TTTTTTTTGG TTTTGAACCA AATCTTCTTT TGTCCTTTCC CCACAGATAA
TATCTTCTTT TATCCTCACA TTTTTGTGGT CTATATATGC CATGTAAATA TGCTGGTAGG TTTTCTGTAT TCCATACATC
GCCAAATGTG GCGAGGTTTC ATATGACCTT TTAGCTTTGG AAATGTAAAC TTTATAAGAG CATTGTTGTC AG

Locus: Os06g0554800

Loading...

Locus: Os06g0554800

Loading...