Os06t0556000-01

Locus

Os06g0556000

Description

Amino acid permease, Transport of amino acids

RAP-DB Gene Symbol Synonym(s)

OsAAP12A, AAP12A, OsAAP3, AAP3

RAP-DB Gene Name Synonym(s)

amino acid permease 12A, amino acid permease 3, amino acid/auxin permease 3

CGSNL Gene Symbol

AAP12A

CGSNL Gene Name

AMINO ACID PERMEASE 12A

Oryzabase Gene Symbol Synonym(s)

OsAAP12A, OsAAP3, AAP3

Oryzabase Gene Name Synonym(s)

amino acid permease 12A, amino acid permease 3, amino acid/auxin permease 3

Transcript Evidence

AK102763

Protein Evidence

Q5Z9R9

Literature

PMID: 25907566

PMID: 23166615

Note

Manual Curation

September 3, 2015

Functional domain (InterPro)

Amino acid transporter, transmembrane domain (IPR013057)

Full-length cDNA

J033107D14 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0556000-01)

Others

Oryzabase (18488)

Transcript

1888 bp

>Os06t0556000-01 Amino acid permease, Transport of amino acids
GCATCGCATCCTCTCCCCACACAATCCCCACCCGGCCTAGCGAGCGAGAGAGAGGGAAGG
GTTGCGACTTGCGACTCGCGAGCGGCGAGATGGCGAAGGACGTGGAGATGGCGGTGCGGA
ACGGAGACGGCGGCGGCGGCGGCGGCTACTACGCCACCCACCCGCACGGCGGCGCCGGCG
GCGAGGACGTCGACGACGACGGCAAGCAGCGGCGAACCGGTAACGTATGGACGGCGAGCG
CGCACATCATCACGGCGGTGATCGGCTCCGGCGTGCTCTCTCTCGCATGGGCAACGGCGC
AGCTCGGCTGGGTGGTCGGGCCGGTGACTCTGATGCTCTTCGCCCTCATCACGTACTACA
CCTCTGGGCTCCTCGCCGACTGCTACCGCACTGGCGATCCGGTCAGCGGCAAGCGCAACT
ACACCTACATGGATGCCGTTGCGGCCTACTTAGGTGGCTGGCAAGTCTGGTCCTGTGGTG
TTTTCCAATATGTCAACCTGGTTGGGACAGCAATTGGGTACACAATCACAGCATCCATCA
GCGCAGCGGCTGTGCACAAGGCCAACTGCTACCACAAGAACGGCCACGATGCCGATTGCG
GTGTCTACGACACCACGTACATGATCGTCTTTGGAGTCGTCCAGATCTTCTTCTCCATGC
TGCCCAACTTCAGTGACCTCTCATGGCTTTCCATCCTCGCCGCGGTCATGTCATTCTCAT
ACTCGACCATTGCCGTTGGCCTCTCGCTTGCGCGAACAATATCAGGTGCTACTGGTAAGA
CTACTCTGACTGGCGTTGAGGTTGGAGTTGACGTCACTTCAGCCCAGAAGATCTGGCTCG
CGTTCCAAGCGCTCGGTGACATCGCGTTCGCCTACTCCTACTCCATGATCCTTATAGAAA
TTCAGGACACGGTGAAGTCTCCACCGGCGGAGAACAAGACGATGAAGAAGGCAACGCTGC
TGGGGGTGTCGACCACGACGGCGTTCTACATGCTGTGCGGGTGCCTGGGGTACGCGGCGT
TCGGGAACGCGGCGCCGGGGAACATGCTCACCGGGTTCGGCTTCTACGAGCCCTACTGGC
TGATCGACTTCGCCAACGTCTGCATCGTGGTCCACCTGGTCGGCGCCTACCAGGTGTTCT
GCCAGCCCATCTTCGCCGCCGTCGAGACGTTCGCCGCCAGGCGGTGGCCGGGCTCGGAGT
TCATCACCCGGGAGCGCCCCGTCGTGGCCGGCAGGTCGTTCAGCGTCAACATGTTCAGGC
TGACGTGGCGGACGGCGTTCGTGGTCGTCAGCACGGTGCTCGCCATCGTGATGCCCTTCT
TCAACGACATCCTGGGCTTCCTCGGCGCCGTCGGGTTCTGGCCGCTGACGGTGTACTACC
CGGTGGAGATGTACATCCGGCAGCGGCGGATACAGCGGTACACGTCCAGGTGGGTGGCGC
TGCAGACGCTCAGCCTCCTCTGCTTCCTCGTCTCGCTCGCCTCCGCCGTCGCCTCCATCG
AGGGCGTCAGCGAGTCGCTCAAGCACTACGTCCCCTTCAAGACCAAGTCGTGATCCCGAT
CACGACGGCCTTTTTTTTTTGCTTTTGCATCCTGATGAAAAAAGATTTCAGAAACATATG
CACAACAAATGCCGGAAGTTAGCCAAGAGTTTGGTCACCAGCTCGGTGCGTTGGTCGGTC
AGGAGGAGGAGGGTTCAACTTGTGTAGGTTAAGAAATGCTAGAGAGTATGGAGACCATCT
TCGATTGCTGCTCATGTATAGAAAAAAGAGGAAGCTTCGTATTCATGTAATGAATCGGAA
TGTTTAACAAACAAGGCTTGTTCTGAACTCTTCTCAGGGACAGGCATGGATAACAGATTA
AAGATAAATGAATGTGTTAGACAAGGGC

CDS

1464 bp

>Os06t0556000-01 Amino acid permease, Transport of amino acids
ATGGCGAAGGACGTGGAGATGGCGGTGCGGAACGGAGACGGCGGCGGCGGCGGCGGCTAC
TACGCCACCCACCCGCACGGCGGCGCCGGCGGCGAGGACGTCGACGACGACGGCAAGCAG
CGGCGAACCGGTAACGTATGGACGGCGAGCGCGCACATCATCACGGCGGTGATCGGCTCC
GGCGTGCTCTCTCTCGCATGGGCAACGGCGCAGCTCGGCTGGGTGGTCGGGCCGGTGACT
CTGATGCTCTTCGCCCTCATCACGTACTACACCTCTGGGCTCCTCGCCGACTGCTACCGC
ACTGGCGATCCGGTCAGCGGCAAGCGCAACTACACCTACATGGATGCCGTTGCGGCCTAC
TTAGGTGGCTGGCAAGTCTGGTCCTGTGGTGTTTTCCAATATGTCAACCTGGTTGGGACA
GCAATTGGGTACACAATCACAGCATCCATCAGCGCAGCGGCTGTGCACAAGGCCAACTGC
TACCACAAGAACGGCCACGATGCCGATTGCGGTGTCTACGACACCACGTACATGATCGTC
TTTGGAGTCGTCCAGATCTTCTTCTCCATGCTGCCCAACTTCAGTGACCTCTCATGGCTT
TCCATCCTCGCCGCGGTCATGTCATTCTCATACTCGACCATTGCCGTTGGCCTCTCGCTT
GCGCGAACAATATCAGGTGCTACTGGTAAGACTACTCTGACTGGCGTTGAGGTTGGAGTT
GACGTCACTTCAGCCCAGAAGATCTGGCTCGCGTTCCAAGCGCTCGGTGACATCGCGTTC
GCCTACTCCTACTCCATGATCCTTATAGAAATTCAGGACACGGTGAAGTCTCCACCGGCG
GAGAACAAGACGATGAAGAAGGCAACGCTGCTGGGGGTGTCGACCACGACGGCGTTCTAC
ATGCTGTGCGGGTGCCTGGGGTACGCGGCGTTCGGGAACGCGGCGCCGGGGAACATGCTC
ACCGGGTTCGGCTTCTACGAGCCCTACTGGCTGATCGACTTCGCCAACGTCTGCATCGTG
GTCCACCTGGTCGGCGCCTACCAGGTGTTCTGCCAGCCCATCTTCGCCGCCGTCGAGACG
TTCGCCGCCAGGCGGTGGCCGGGCTCGGAGTTCATCACCCGGGAGCGCCCCGTCGTGGCC
GGCAGGTCGTTCAGCGTCAACATGTTCAGGCTGACGTGGCGGACGGCGTTCGTGGTCGTC
AGCACGGTGCTCGCCATCGTGATGCCCTTCTTCAACGACATCCTGGGCTTCCTCGGCGCC
GTCGGGTTCTGGCCGCTGACGGTGTACTACCCGGTGGAGATGTACATCCGGCAGCGGCGG
ATACAGCGGTACACGTCCAGGTGGGTGGCGCTGCAGACGCTCAGCCTCCTCTGCTTCCTC
GTCTCGCTCGCCTCCGCCGTCGCCTCCATCGAGGGCGTCAGCGAGTCGCTCAAGCACTAC
GTCCCCTTCAAGACCAAGTCGTGA

Protein

488 aa

>Os06t0556000-01 Amino acid permease, Transport of amino acids
MAKDVEMAVRNGDGGGGGGYYATHPHGGAGGEDVDDDGKQRRTGNVWTASAHIITAVIGS
GVLSLAWATAQLGWVVGPVTLMLFALITYYTSGLLADCYRTGDPVSGKRNYTYMDAVAAY
LGGWQVWSCGVFQYVNLVGTAIGYTITASISAAAVHKANCYHKNGHDADCGVYDTTYMIV
FGVVQIFFSMLPNFSDLSWLSILAAVMSFSYSTIAVGLSLARTISGATGKTTLTGVEVGV
DVTSAQKIWLAFQALGDIAFAYSYSMILIEIQDTVKSPPAENKTMKKATLLGVSTTTAFY
MLCGCLGYAAFGNAAPGNMLTGFGFYEPYWLIDFANVCIVVHLVGAYQVFCQPIFAAVET
FAARRWPGSEFITRERPVVAGRSFSVNMFRLTWRTAFVVVSTVLAIVMPFFNDILGFLGA
VGFWPLTVYYPVEMYIRQRRIQRYTSRWVALQTLSLLCFLVSLASAVASIEGVSESLKHY
VPFKTKS*

5'UTR

chr06:21185223..21185311 (+ strand) : 89 bp

CDS

chr06:21185312..21185441 (+ strand) : 130 bp

chr06:21189662..21189895 (+ strand) : 234 bp

chr06:21190255..21190348 (+ strand) : 94 bp

chr06:21190473..21190690 (+ strand) : 218 bp

chr06:21190776..21190915 (+ strand) : 140 bp

chr06:21191051..21191698 (+ strand) : 648 bp

3'UTR

chr06:21191699..21192033 (+ strand) : 335 bp

FASTA

>Os06t0556000-01 class=Sequence position=chr06:21185223..21192033 (+ strand)
GCATCGCATC CTCTCCCCAC ACAATCCCCA CCCGGCCTAG CGAGCGAGAG AGAGGGAAGG GTTGCGACTT GCGACTCGCG
AGCGGCGAGA TGGCGAAGGA CGTGGAGATG GCGGTGCGGA ACGGAGACGG CGGCGGCGGC GGCGGCTACT ACGCCACCCA
CCCGCACGGC GGCGCCGGCG GCGAGGACGT CGACGACGAC GGCAAGCAGC GGCGAACCGG TACGGATCAA ACCCGACCCC
GACCCCTCGT GATTCCCCCG TCTCGTTAAC CCTCCTCTTC TCCTCCCTCC GCCATGGATG ATGATGTGGC TGTGCTGTTG
TGTTTCCGTG CGGTGCGTGC GTGTCCTTGT GGTGGATTGG ATTTTTTGCG GTTTTTGCTT CCTATTTTTG GGCGCATATA
TGCCCGCTTT ATCAATCTCG CTTAGAGTCG AGTGGATCAT CCTACTCATC AAAAGGGAGG TCTAGAAACA CGGTGCACGC
GAGATTTCTG GTAGGGAAAA CTCCACGAAA AGTTGGTTCA AATTCGAGAC AAAGTAGTTC GAATTCAAAA AAAAAAAACC
GAAACGTTTC AAGGGATCGG AAGGCGTGAA CAACCATGGT CCTAGCTGGA CCCTTGTCAT CTCCTCGGTT TCTGTTCCAA
TCTAGCGAGC GGCGCGGCGC CGCCTCGGAT GGATTTTTGG TTGGTGCTGA CTGCTTGACT TCTGCGTTTT CTTCCTCCCT
TTTCCCGGAA ACTCCCATGG ATTTTGGTTG GTTGGTGGCG CTCTGGTGCG GTAGGCTTCG TCCATAGCCA ACACCGCCAA
TTAAGCCGCC ATGAATGGAC ATCGTTGTGC GTATGTATCG TGGTAAAAAA AAATCGAACT ACAGTGTTCT CTGTGAAGTG
AAACCCTGGA GAATTTTTAC TGCGTTCAAG ATAAACGGTG TGCGCTTTTT TTTTTGTGTT TGTGTTTCCC TTTTTGGGTT
CCCCAACGGA GCGCATGCAA GCGTCCGGCG ACGTGTACGC TGGGTTTTTT TTTCCAGCAC TTCGTCTAGA TCTGTCTGTT
CCTAGAGTCC AAAATTAATT AATTAATTAA TTAAGTATGT AGAGGTTCAA AATTAATTAA TTAGTTAGTG GAAGCACGGG
AGGTATGGTG GTGGAGTCGT GGACACTTCA CACATTAGGA TTAAAATCCG TGCATGAATT TTAGTGAGAT CAACTATATA
TCGCTTCACC CATCAAGACT AAAATCCCGT GTTaaggctt gtttagttca taccaaaatt gaaagtttgg ttgaaattga
aacgatgtga cagaaaaatt agaagtttgc gtgtgtagga aagttttgat atgatgaaaa agttagaagt ttgaagaatt
attttggaat taaacacggc ctAAAATTTT AATGAGATCA GGGATATATC GCTAGTTTAT TAGTTTTCAT CTTTTAGGGC
ATATATTAGG GAACATATTT ATAAAAATGT GTGGGttttc gagtctattt gaattgtttc cctaccaatt ttttgtagtg
ccaaaatcta ggcaagtttt ggcactacca aatatttggt aaggtaagat tgttttttat catatttggt ttgctacaac
atagagtcaa aatgtgaaat tgtagtaaag aatgttcata atgccaaatc tatattaggt aggagtacca ataaatgggc
ttcaattcaa atcaaacaca agtactattt aaattaccaa aatattggta gggcagtttt tggtagcaat ccaaattagc
ccttcatctt TTAGTGTTTC ATGTGTATGT GTATGTGCTA TCTAATCGAA AAAAAAAATT AGTTAATCAA GAATTAACTA
ATTTTTATAT CACGTGAATA ATTTGGCTTG CGCCGTTCCG CGTCGTGCGC GCTGTCGGAT GCTGGATGCA AGAGGCCAGA
GCCAACCATC CACAGCACCT AGCACAGCAG GGGGTCGCGC GCTGGTCAAC AGCCGCGTAC CCCCACGGTC AACGCGCATC
AGCCACTCGA TCTGAGGCAT GCACGGTCTA GATGATGCCA CGTTCGCAAT AAAAGCTCCC CCTGATCAAC AAGTGACGTG
CTGTTTCACG GAGTGTGACG TGGCACGGGC AGTATAGTAC GTGTACGTGT GAACACACGC GCATGCGACA GCGCATTTCC
ACGCGTGCAA TTCTGACTCG CAAAAAGCGT ATAGTAGTAC TAGCTGCTTT TTTGCAATTT GTATTCCTTG AACGGCACAA
CGTGTTTGGT GGAAAATTCA TAAAAGTCAC CGTACTTTTT GACGAAAAAC GGATATATGC TTGGTTGAGC GGTCCACTTT
AAGCTACCAA TATCGATTAT CTTATCGTTA GTCAGCTTCA GTGAGATCAT ATCTAAAGTA ACTGGTGCTG AACTCGTCAA
GGAATCATTC CGGCGGCCTG AAAGCCCCTC TTTGGATGGC TCTGCGCCTC TGCCTGGCCG CTTCCGATCG GCCGGAATCT
ATGTCCTCGT ACCTTTTACG CAGCACCAAC TGATGATTGC GTGCTTTCAA CATATTTTGG TTTGGAACGC AGTGATCTCG
TATTTTATTC GAAATGCGTA AAAGCTTTGT TGATTCTACG GAAACGCTCT TTGGTTTGTA GAaaaaaaac ccttcatata
tcttttcctt tgaaattcct ttgtaatgac aatcttgtaa atagtttgga ATTTTTTTCA TAAGATAATA TCATCCGACG
TGACTAGGGa ttttaagttt ttgtttgcga ccacttatct tatttaaaaa atttgtgcaa atagaaaaaa cgaaaagctg
tgcttaaagt actttggata ataaagtaaa taataaaaag aaataataat tccaaatttt tttaaataag atgagtggtc
aaatagtgca aataaaaact cagaataggg acggagggag taGTTTCTAA GGCCTGGTGG TCGGCATGAA CCAATCTTTT
TTTTTTTCTA GCTGTACCTA AACACCTGTT TTAAAGTTTT CTTTCTCGTA GAATCATACT GTATGTAGAA TTGAAGAAAC
TATGCCATCC TATTCATGTG CTTTTACATA CTCTTCCCTA TTCTTATGTT TTGAGTTTTC TTCCTTCTAG AGGGCCCTTG
TTTCTCTGTA ATGTGAAGTT CTTTAGTGCC AACTGCCAAG ACCTTAATCA CGGACTAAgg gtctgtttag cggagtttaa
aattctgatc aacaaccagc tggtagccaa cttctaagaa tctggaaaaa ttagattcta taactacagc ttctcagaat
ttataccaaa aactgatcta tttaggggag attctgattc tggaaaaagc tgcaggagct aaaatctccc ttaaacgggc
TCTAAGTGGA TCCACTATAT ATATAGTGGA CTTTTGTCTT ATCTCAGTTC TTTCAACGGA GTACTAGGCA CAGCCCATAT
TGTGAAGGAG AAGAAAATGG CCAGACCTTT TGACTGCGAG GCATGGGCTG GATAGTCTTT GGGATGAGGT GACCGATGCG
AGGGTAATAG ATGCGCCGTA GACCTGCTGT TTCTGACCTT TTGGCGCACA GCTCTACGCA CGACAACTCT ACTCCGTGTA
GGATAGTGTA GGCTAGTGTA GCGGTACTGA GTATTCCGTA TTCGTGCTGT ACAACCGTGG TGTGCTCCCT GCGTACGGTG
GTTTGGGGAT TTTTTTTCAC AAAATATGTG GATTTTTTAA AAATAAAGCT ATCTAAATCT TGCGGAGTTA TTGTAATGGT
ATTTTTTGGG ATAATTTTTC ATGACAGGTA TTGTGCATTG ATATAGTTAG TGGGCCTTTT TGAATGGTTA AAGTGAAAAT
ATTTTTCACT GAACGCTTTC TAAACGTCAA TGCATTTATG AATAGAGTAG AGAGTACTAT GGAGTCTGAC CTTCTCAGAT
GGGAGACTCT CTAGCTACCG GGATGATACT AGACCTTTGT GTTCATCAAG AGATCACATG TTCACATGTG TAGGCCCTTT
ATATATGTTG AGTTGTTGAC TTGTGTTCTT CAGAGGGTGA CAGTCTCCAT GGCTCAATGA TTTGTTTGGA ATTGTCTATT
CTGTTTCAGT TGGCATGGGA CATGGGTCTT GTACTCTGTC CCAAAGTGTG CATGTGTCCT CATCCGATTA ATCAAGGCAC
TGTGTTAATC ATTCTTTAGA AACTCATTAA CTGTATGCAT ACATAGACTG ATTGAGGGGC TACAGATCAT AAACCATGGA
TGCATGTGGG TATTAATCAT TTTTTACCCT CGGTTTGGTG CATGCTGTCA CTAAGTGGAG TGAACTTGTT CACAGTTGAG
ATTATGAGTA AATATCAAGG AGACAAGAAC TGAAATTCGA AAGGAATTAA AGTCATAAAT GAAATGATTG AATTTTCAGA
ATGTTGAAGG ACTGAAAACT TGTGCAATTC GTTGAGCAGG TAACGTATGG ACGGCGAGCG CGCACATCAT CACGGCGGTG
ATCGGCTCCG GCGTGCTCTC TCTCGCATGG GCAACGGCGC AGCTCGGCTG GGTGGTCGGG CCGGTGACTC TGATGCTCTT
CGCCCTCATC ACGTACTACA CCTCTGGGCT CCTCGCCGAC TGCTACCGCA CTGGCGATCC GGTCAGCGGC AAGCGCAACT
ACACCTACAT GGATGCCGTT GCGGCCTACT TAGGTAAAta ctattccttc catttcaaaa tatatggagc tgttgacttt
aatataatgt ttgttcattc gtattattta aaaattatat aaatattatt tattttgttg tgacttgttt tatcaatata
gaaactagtc ttaacttata cttttacata tttacactaa aattttgaat aaaacgaatg tcaaacgtta tacgaaaaat
caacaccgtc atacattttg aaattgaaat ggaggtagGA ATAACAAGCT GTGTCTACAT GAACATCGAT ATGCATGCGT
CAGAGAATTT AGAATTTTTT CTCTGAATTC AGAGATGTCA TACGAGCCTT GTTGCTGTTC TTAAATATGC AGGTGGCTGG
CAAGTCTGGT CCTGTGGTGT TTTCCAATAT GTCAACCTGG TTGGGACAGC AATTGGGTAC ACAATCACAG CATCCATCAG
CGCAGCGTAA GTTCTGAAGA ATTGATCTGT TCATAAATCA CAATGGCATA CTACAATTCT CCATTGCTTT CACAACTCAA
TGCTATGCAC GGTTCTGACT TCTGAGGTTA ATTTGAATGA TCTTCTACAG GGCTGTGCAC AAGGCCAACT GCTACCACAA
GAACGGCCAC GATGCCGATT GCGGTGTCTA CGACACCACG TACATGATCG TCTTTGGAGT CGTCCAGATC TTCTTCTCCA
TGCTGCCCAA CTTCAGTGAC CTCTCATGGC TTTCCATCCT CGCCGCGGTC ATGTCATTCT CATACTCGAC CATTGCCGTT
GGCCTCTCGC TTGCGCGAAC AATATCAGGT GAAGAAATCT TTCTGAAGAT GGTATCAGTG TCACTGCATA TATAGTTTGT
AAGCTTTCTC ATCATCTCCA TGTGTCTGTA CAGGTGCTAC TGGTAAGACT ACTCTGACTG GCGTTGAGGT TGGAGTTGAC
GTCACTTCAG CCCAGAAGAT CTGGCTCGCG TTCCAAGCGC TCGGTGACAT CGCGTTCGCC TACTCCTACT CCATGATCCT
TATAGAAATT CAGGTAAGCT GTGCACAGCA AAGTTCAGAG TTTGAGAAAC ATTTGAGCAA CAGTCACAAA CATGTCTCAG
TTTGTTTGCT TGCAAGGTTT TTAAGTAACC GATGATGAGT CTGAAAAAAA TGGCATTTGA AATTGCAGGA CACGGTGAAG
TCTCCACCGG CGGAGAACAA GACGATGAAG AAGGCAACGC TGCTGGGGGT GTCGACCACG ACGGCGTTCT ACATGCTGTG
CGGGTGCCTG GGGTACGCGG CGTTCGGGAA CGCGGCGCCG GGGAACATGC TCACCGGGTT CGGCTTCTAC GAGCCCTACT
GGCTGATCGA CTTCGCCAAC GTCTGCATCG TGGTCCACCT GGTCGGCGCC TACCAGGTGT TCTGCCAGCC CATCTTCGCC
GCCGTCGAGA CGTTCGCCGC CAGGCGGTGG CCGGGCTCGG AGTTCATCAC CCGGGAGCGC CCCGTCGTGG CCGGCAGGTC
GTTCAGCGTC AACATGTTCA GGCTGACGTG GCGGACGGCG TTCGTGGTCG TCAGCACGGT GCTCGCCATC GTGATGCCCT
TCTTCAACGA CATCCTGGGC TTCCTCGGCG CCGTCGGGTT CTGGCCGCTG ACGGTGTACT ACCCGGTGGA GATGTACATC
CGGCAGCGGC GGATACAGCG GTACACGTCC AGGTGGGTGG CGCTGCAGAC GCTCAGCCTC CTCTGCTTCC TCGTCTCGCT
CGCCTCCGCC GTCGCCTCCA TCGAGGGCGT CAGCGAGTCG CTCAAGCACT ACGTCCCCTT CAAGACCAAG TCGTGATCCC
GATCACGACG GCCTTTTTTT TTTGCTTTTG CATCCTGATG AAAAAAGATT TCAGAAACAT ATGCACAACA AATGCCGGAA
GTTAGCCAAG AGTTTGGTCA CCAGCTCGGT GCGTTGGTCG GTCAGGAGGA GGAGGGTTCA ACTTGTGTAG GTTAAGAAAT
GCTAGAGAGT ATGGAGACCA TCTTCGATTG CTGCTCATGT ATAGAAAAAA GAGGAAGCTT CGTATTCATG TAATGAATCG
GAATGTTTAA CAAACAAGGC TTGTTCTGAA CTCTTCTCAG GGACAGGCAT GGATAACAGA TTAAAGATAA ATGAATGTGT
TAGACAAGGG C

Locus: Os06g0556000

Loading...

Locus: Os06g0556000

Loading...