Os06t0560700-01

Locus

Os06g0560700

Description

Lipase, GDSL domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GELP86

CGSNL Gene Name

GDSL ESTERASE/LIPASE PROTEIN 86

Oryzabase Gene Symbol Synonym(s)

OsGELP86

Oryzabase Gene Name Synonym(s)

GDSL esterase/lipase protein 86

Transcript Evidence

AK063332 (DDBJ, Best hit)

Protein Evidence

NP_001150646.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Lipase, GDSL (IPR001087)

Full-length cDNA

001-114-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0560700-01)

RiceXPro (AK063332)

Others

Oryzabase (11036)

KEGG (Os06t0560700-01)

Transcript

1349 bp

>Os06t0560700-01 Lipase, GDSL domain containing protein.
ACATTATCTAGCTCATCAGCTTGCCGGCCATGGCCAAGCTCGTCGGAGCAACTCTCTACC
TCTACCTCTTCCTCTTCCTCCTGCTGCTGCATCTCCATTGCCACCAATGCAAACCTGCTG
CTGCTGCGAGCTTCGTCGTCCATGgcggcggcggagcaacggcaagggcggcggcggtga
gggcggtgttcgtgttcgggagctcgctggtggacaacggcaacaacaaccacctgaacg
gctccggcgccgtgcgcgccgactacgcgccctacggcgtcgacttcccgctgggcgcca
ccggccgcttctccaacggccgcaacgtcatcgacGCCCTCGGGGAGCTCCTCCGCCTCC
CCGCCGCCGGCCTCCTCCCGCCTTTCGCCGACCCCGCCACCCGCGGCCGCGCCGCCCTCC
ACGGCGTCAACTTCGCCTCCGGCGGCTCCGGCATCCTCGACCTCACCGGCAAGAACAAGG
GAGAGGTCTTGAGCCTAAAGCAGCAGATCACCAACTTTGAGGCAGTGACACTCCCTGACC
TGCGGGCCCACCTGCAGGGAGCAACCACAGCCACCACCACCACCGGACACAAGATGAAGG
GCCAGGATTTCTTTGACCAGTGTTACCTGCCCAAGAGCCTGTTTATCATTGGGACAGGTG
GCAATGACTACTTGCTCAACTACTTCAACGCTGGTAGTGGGCCCACAAGGGCCCCCTTGT
CAGAGTTCACAAGCTCACTCCTCACCAAGCTCTCAAACCACCTGCAGAGATTGTATGATC
TAGGGGCAAGGAAGTTTGTGCTATTCTCCATCCAACCCCTGGGTTGCACCCCTGTGGTGA
GGACCTTCCTCAACGCTACCAGTGATGCTTGCATTGAGCCGATGAACCATGCGGCGCTCC
TCTTCAACTCTGGGCTAAGATCTATCGTTAAAAATCACAATGGTGGCGTGAGGTCACACA
TGCCCGCCGCGAGCTTCGTCTACGTCAATTCCTACAAGATCATTAGCGATATAATACAGC
ACCCGGCAAAATATGGCATCAGGAAAACGAGTCGAGCTTGCTGTGAGGTGTCGAGGGGAG
GCGTGCTGTGTCAGAAGGGGGGGGCCATCTGCAGTGACAGGACCAAGTACGCCTTCTTCG
ATGGGCTCCACCCGACAGACGTGGTGAATGCCAGGCTGGCACGCAAGGCGTACGGCTCCA
ACTCGCCGGACAAAGTCTACCCTATCAATGTTAAGAAGTTGGCAATGCTGTAGCAGTAGT
AATAATTAATCATCTCTAATTGTAATTAAGTCATACTTAATTAGTATTACTAGCTAGTAG
TTGTGAAATGGATAATTAGCTCTAGTGAC

CDS

1224 bp

>Os06t0560700-01 Lipase, GDSL domain containing protein.
ATGGCCAAGCTCGTCGGAGCAACTCTCTACCTCTACCTCTTCCTCTTCCTCCTGCTGCTG
CATCTCCATTGCCACCAATGCAAACCTGCTGCTGCTGCGAGCTTCGTCGTCCATGgcggc
ggcggagcaacggcaagggcggcggcggtgagggcggtgttcgtgttcgggagctcgctg
gtggacaacggcaacaacaaccacctgaacggctccggcgccgtgcgcgccgactacgcg
ccctacggcgtcgacttcccgctgggcgccaccggccgcttctccaacggccgcaacgtc
atcgacGCCCTCGGGGAGCTCCTCCGCCTCCCCGCCGCCGGCCTCCTCCCGCCTTTCGCC
GACCCCGCCACCCGCGGCCGCGCCGCCCTCCACGGCGTCAACTTCGCCTCCGGCGGCTCC
GGCATCCTCGACCTCACCGGCAAGAACAAGGGAGAGGTCTTGAGCCTAAAGCAGCAGATC
ACCAACTTTGAGGCAGTGACACTCCCTGACCTGCGGGCCCACCTGCAGGGAGCAACCACA
GCCACCACCACCACCGGACACAAGATGAAGGGCCAGGATTTCTTTGACCAGTGTTACCTG
CCCAAGAGCCTGTTTATCATTGGGACAGGTGGCAATGACTACTTGCTCAACTACTTCAAC
GCTGGTAGTGGGCCCACAAGGGCCCCCTTGTCAGAGTTCACAAGCTCACTCCTCACCAAG
CTCTCAAACCACCTGCAGAGATTGTATGATCTAGGGGCAAGGAAGTTTGTGCTATTCTCC
ATCCAACCCCTGGGTTGCACCCCTGTGGTGAGGACCTTCCTCAACGCTACCAGTGATGCT
TGCATTGAGCCGATGAACCATGCGGCGCTCCTCTTCAACTCTGGGCTAAGATCTATCGTT
AAAAATCACAATGGTGGCGTGAGGTCACACATGCCCGCCGCGAGCTTCGTCTACGTCAAT
TCCTACAAGATCATTAGCGATATAATACAGCACCCGGCAAAATATGGCATCAGGAAAACG
AGTCGAGCTTGCTGTGAGGTGTCGAGGGGAGGCGTGCTGTGTCAGAAGGGGGGGGCCATC
TGCAGTGACAGGACCAAGTACGCCTTCTTCGATGGGCTCCACCCGACAGACGTGGTGAAT
GCCAGGCTGGCACGCAAGGCGTACGGCTCCAACTCGCCGGACAAAGTCTACCCTATCAAT
GTTAAGAAGTTGGCAATGCTGTAG

Protein

408 aa

>Os06t0560700-01 Lipase, GDSL domain containing protein.
MAKLVGATLYLYLFLFLLLLHLHCHQCKPAAAASFVVHGGGGATARAAAVRAVFVFGSSL
VDNGNNNHLNGSGAVRADYAPYGVDFPLGATGRFSNGRNVIDALGELLRLPAAGLLPPFA
DPATRGRAALHGVNFASGGSGILDLTGKNKGEVLSLKQQITNFEAVTLPDLRAHLQGATT
ATTTTGHKMKGQDFFDQCYLPKSLFIIGTGGNDYLLNYFNAGSGPTRAPLSEFTSSLLTK
LSNHLQRLYDLGARKFVLFSIQPLGCTPVVRTFLNATSDACIEPMNHAALLFNSGLRSIV
KNHNGGVRSHMPAASFVYVNSYKIISDIIQHPAKYGIRKTSRACCEVSRGGVLCQKGGAI
CSDRTKYAFFDGLHPTDVVNARLARKAYGSNSPDKVYPINVKKLAML*

5'UTR

chr06:21447774..21447802 (+ strand) : 29 bp

CDS

chr06:21447803..21448252 (+ strand) : 450 bp

chr06:21449130..21449417 (+ strand) : 288 bp

chr06:21449853..21450120 (+ strand) : 268 bp

chr06:21450680..21450897 (+ strand) : 218 bp

3'UTR

chr06:21450898..21450993 (+ strand) : 96 bp

FASTA

>Os06t0560700-01 class=Sequence position=chr06:21447774..21450993 (+ strand)
ACATTATCTA GCTCATCAGC TTGCCGGCCA TGGCCAAGCT CGTCGGAGCA ACTCTCTACC TCTACCTCTT CCTCTTCCTC
CTGCTGCTGC ATCTCCATTG CCACCAATGC AAACCTGCTG CTGCTGCGAG CTTCGTCGTC CATGgcggcg gcggagcaac
ggcaagggcg gcggcggtga gggcggtgtt cgtgttcggg agctcgctgg tggacaacgg caacaacaac cacctgaacg
gctccggcgc cgtgcgcgcc gactacgcgc cctacggcgt cgacttcccg ctgggcgcca ccggccgctt ctccaacggc
cgcaacgtca tcgacGCCCT CGGGGAGCTC CTCCGCCTCC CCGCCGCCGG CCTCCTCCCG CCTTTCGCCG ACCCCGCCAC
CCGCGGCCGC GCCGCCCTCC ACGGCGTCAA CTTCGCCTCC GGCGGCTCCG GCATCCTCGA CCTCACCGGC AAGAACAAGG
TCTGCGTTAC TTGATGAGCA ATTGTCCCTA TATAGTAATt cccttcgttc taaaaatata cgatgacgct gactttttta
taatgtttga tcaatcattt tgtttttttt aaaaatataa atattgtttg ttttattgtt acttgtttta ttataaaaaa
ctataatcta acttctattt ttacaaattt atattgaatt tttgaataaa tagatggcca aacaatatgt aaaaagttaa
cggcgtcgta tgttttagga tggaTGGAGT ATACTTCTTC ATTCCTTGTA ATGATGCTTG CGTTTATTTG AGGGTGAGGC
TCTATTCGGT TGAGCTAAGG CTGAAGTTGT GAAAAAAAAG GTTCAAGACA TATTTTTGGT AAAATTATTA TGGGCTGATT
TGGTTTAAAA CCCTACTAAA ATACTGGTAG TGTTAAAATC TAGATAAATT TTGACGCGGT CAAATTTTGT AGGGCGATAT
ATTACTAGCT AGGTAAaaaa tttggtctta atccaaatac caacaaaaca ctatttgaaa ctaccaaaAC AAATTGGAAC
CAATCCAAAC ATCCCCTATA AATCTATTCT TAAAAGTTTG AAAGCCACAA CTAGAAACAT AATGCCATAA AGAAACCTCA
AATCAACTTA TAAACTAAGC ATCAAAATAG ATTGCTTCCC TTGGATGGAT GGTTAGGAGT TTTATTTATA CGCATTGCTT
GCGATGGGTT TTTTATAGGT TTCATTTTTA TAAATTGCTC TGTTGTACTT TTTTTTCTTA ATGAAATAAA GTGTATGGTT
CTTGTGTTTC AAAAGAATTA AGATGTAAAA TTAGCCAGCT TAATTGCTAA TTTGTGTCTG TAACTAATCT TATTAGGGAG
AGGTCTTGAG CCTAAAGCAG CAGATCACCA ACTTTGAGGC AGTGACACTC CCTGACCTGC GGGCCCACCT GCAGGGAGCA
ACCACAGCCA CCACCACCAC CGGACACAAG ATGAAGGGCC AGGATTTCTT TGACCAGTGT TACCTGCCCA AGAGCCTGTT
TATCATTGGG ACAGGTGGCA ATGACTACTT GCTCAACTAC TTCAACGCTG GTAGTGGGCC CACAAGGGCC CCCTTGTCAG
AGTTCACAAG CTCACTCCTC ACCAAGCTCT CAAACCACCT GCAGGTAGTA CCACCTTAAT TTAATGCACA CCTTAATTAA
GTAGGAGTAT ATCTTTGTGT ACCCATAACA TATGGATTTG CTATTAAAGC CACAGATATG GCATGTTAAT TAATTATAAC
TACTGGATAT GGTGGTATAG TTCCTGGTAC ATGTGAAATA AAGAGAAGGA ACTGGGGAGA AAATGTACAG GCAGCTATAT
ATATGTGGAC CTTGAACTCA GACTGAGAAG TAATGAATGT GAAGGGTACA TGACATAATA ATATTGCAAG AGTACATAGT
AGTTGGATGG ATAGTACATT GATTGGTACT GTAGTCTTTC TTTTCTCCAT ATCATCCCTT TTATATTCTT CGAGATTACA
CATAATAATC AACAGATACA ATAAATATCT TTTGTACATG TTTTATTTAA ATTATGACTC TTATTTTTAC TTTTTTCAGA
GATTGTATGA TCTAGGGGCA AGGAAGTTTG TGCTATTCTC CATCCAACCC CTGGGTTGCA CCCCTGTGGT GAGGACCTTC
CTCAACGCTA CCAGTGATGC TTGCATTGAG CCGATGAACC ATGCGGCGCT CCTCTTCAAC TCTGGGCTAA GATCTATCGT
TAAAAATCAC AATGGTGGCG TGAGGTCACA CATGCCCGCC GCGAGCTTCG TCTACGTCAA TTCCTACAAG ATCATTAGCG
ATATAATACA GCACCCGGCA AAATATGGTA ATAATTAAGC GATCATATAT TTCTGAAACT CAAAAGAAAT TAGTTATGAG
TGAAATGATG CACCCTCCCC TTTTCCTTTC CTACCACTAC TATTTTCTCG TGATATTTCC AGGGTCTATT TGGTAGGGGA
ATTTTAAAGA AAAACAAAAG GAATTTAAAA TTATAGTCTT TTTAGCTATA TAGCTGTTTG GAATGCAGGA ATGGATCAAG
AATCCCTTGA AAAAACTTTC CTAACATTAT CTATTCTATT GTTATTCTAG TGCAAATCAA GGGAAAAAAT GTCCTCAAAT
CTAGGGAAAA AATTCCTTGA AAGAATCTAT TACACCTTTT TTATTTTAAG CAAGTCTAAA ATTCATGTTC CAAAACCACG
TCCATATTAA TTTTTCAGTG TTGTTTTTTT AATTATTCAT ATATTTCTAT ATATTTCTTT TTCCTACAAT ATTATTATTC
ATGTGTTTTT GTCCATCAAT CCAAACATTC CTCATCACTC GTGCAAGCAA CAAAGCTAGC TGTATTAAGT GCCTAATTTG
CTTTGATGGT TTTTATAATT GCTCAGGCAT CAGGAAAACG AGTCGAGCTT GCTGTGAGGT GTCGAGGGGA GGCGTGCTGT
GTCAGAAGGG GGGGGCCATC TGCAGTGACA GGACCAAGTA CGCCTTCTTC GATGGGCTCC ACCCGACAGA CGTGGTGAAT
GCCAGGCTGG CACGCAAGGC GTACGGCTCC AACTCGCCGG ACAAAGTCTA CCCTATCAAT GTTAAGAAGT TGGCAATGCT
GTAGCAGTAG TAATAATTAA TCATCTCTAA TTGTAATTAA GTCATACTTA ATTAGTATTA CTAGCTAGTA GTTGTGAAAT
GGATAATTAG CTCTAGTGAC