Os06t0570100-01

Locus

Os06g0570100

Description

Ent-kaurene oxidase (EC 1.14.13.78) (AtKO1) (Cytochrome P450 701A3).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

D35

CGSNL Gene Name

DWARF TANGINBOZU

Oryzabase Gene Symbol Synonym(s)

d35, d35(t), dwf30, OsKOL2, KOL2, KO2, OsKO2, OSKO2, KO, CYP701A, CYP701A6, Os KO2, OsKOL2/CYP701A

Oryzabase Gene Name Synonym(s)

tanginbozu dwarf, Tan-Ginbozu, dwarf-35, ent-kaurene oxidase2, cytochrome P450 701A6

Transcript Evidence

AK066285 (DDBJ, Best hit)

Protein Evidence

Q68YV8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

J013068N08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0570100-01)

Others

Oryzabase (68)

KEGG (Os06t0570100-01 (EC:1.14.13.78))

Transcript

1766 bp

>Os06t0570100-01 Ent-kaurene oxidase (EC 1.14.13.78) (AtKO1) (Cytochrome P450 701A3).
GCGAGTTGTCGCTTTTCCTCCCCAACTCCACGATCGAGTGAAGCGGACGAGGGCGACGGC
GGCGAGCGCGCGCACAGCGTGTGATCCATGGAGGCGTTCGTGCCGGGCGGCGCGGGGGCG
GCGGCGGCGGCGGTCGGAGGGTTCGTCGCCGCGGCCGCGCTAGCCGAGAGGGCCGGCGTG
ATCGCGCCAAGGAAACGCCCCAACGCGCCCCCAGCTGTTCCTGGTTTACCCATTATCGGA
AATCTGCATCAACTGAAAGAAAAGAAGCCTCATCAGACCTTTGCAAAATGGGCTGAAATT
TACGGGCCAATCTACACTATAAGAACCGGGGCTTCTTCTGTAGTTGTGCTCAATTCAACT
GAAGTAGCCAAGGAGGCGATGGTTGCAAAATTCTCATCCATATCTACCCGAAAGCTATCC
AAAGCACTGACAGTGCTTACTCGTGATAAATCCATGGTTGCTACCAGCGACTATTGTGAT
TTCCACAAAATGGTGAAGCGTTATGTCATGTCAAGCATGTTGGGTACTTCTGCACAGAAA
CAATTTCGTGACATAAGAGATATGATGATCCATAACATGTTAAGCACTTTTCATAAACTG
GTGAAAGATGACCCACATGCTCCTCTGATATTCAGAGATGTTTTCAAGGATGAGCTATTC
CGGTTGTCCATGATCCAGAGCTTAGGAGAGGATGTGAGTTCAGTCTATGTGGATGAATTT
GGGAGGGACATTTCGAAGGAAGAAATCTACAATGCTACTGTGACCGACATGATGATGTGC
GCAATTGAGGTCGACTGGAGAGATTTCTTCCCCTACCTCAGCTGGGTTCCAAACAAGAGC
TTCGAAACAAGAGTGTTTACTACAGAAACTAGACGAACTGCGGTGATGCGCGCCTTGATC
AAGCAGCAGAAGGAAAGGATTGTGCGTGGAGAGGCAAAGACATGCTATCTGGACTTCTTG
CTGGCAGAGAACACACTGACAGATGAGCAACTGATGATGCTAGTGTGGGAGGCACTCATA
GAGGCTGCAGATACTACCTTGGTCACCACAGAATGGGCCATGTATGAGCTTGCCAAGAAC
CCTGACAAACAGGAACGGCTTTACCAAGAGATCCGGGAGGTGTGCGGCGACGAGACGGTC
ACCGAGGAGCACCTCCCACGGCTGCCGTACCTCAACGCCGTCTTCCACGAGACGCTGCGC
CGCCACTCCCCTGTCCCGCTCATACCTCCGAGGTTCGTCCACGAGGACACCAAGCTCGCT
GGCTACGACGTCCCCGCCGGCACCGAGATGGTGATCAACCTGTACGGGTGCAACATGAAC
AGGAAGGAGTGGGAGTCGCCGGAGGAGTGGGTGCCGGAGAGGTTCGCCGGCGGGAGGCTC
GAGGTGGCGGACATGTACAAGACGATGGCGTTCGGCGCCGGGAGGAGGGCCTGCGCGGGG
AGCCTGCAGGCGACTCACATCGCGTGCGCCGCCGTCGCGCGCTTCGTGCAGGAGTTCGGG
TGGAGGCTGAGGGAGGGTGACGAGGAGAAGGTGGACACCGTGCAGCTCACCGCCTACAAG
CTCCACCCGCTTCATGTCCACCTCACGCGCAGAGGAAGGATGTGAACCATTATATTCATT
GGAAGCTGTTGCTCGTTGAATAATGATATATAGTTATCTTTGAGATGTATTTACTATTAG
CAAAATCTCCATGCTTTGTTATGGATAGGAGAAAACATATTATAATATATCATGGACTAT
ATTTCTTTTATCAAATATGGTTGTAT

CDS

1518 bp

>Os06t0570100-01 Ent-kaurene oxidase (EC 1.14.13.78) (AtKO1) (Cytochrome P450 701A3).
ATGGAGGCGTTCGTGCCGGGCGGCGCGGGGGCGGCGGCGGCGGCGGTCGGAGGGTTCGTC
GCCGCGGCCGCGCTAGCCGAGAGGGCCGGCGTGATCGCGCCAAGGAAACGCCCCAACGCG
CCCCCAGCTGTTCCTGGTTTACCCATTATCGGAAATCTGCATCAACTGAAAGAAAAGAAG
CCTCATCAGACCTTTGCAAAATGGGCTGAAATTTACGGGCCAATCTACACTATAAGAACC
GGGGCTTCTTCTGTAGTTGTGCTCAATTCAACTGAAGTAGCCAAGGAGGCGATGGTTGCA
AAATTCTCATCCATATCTACCCGAAAGCTATCCAAAGCACTGACAGTGCTTACTCGTGAT
AAATCCATGGTTGCTACCAGCGACTATTGTGATTTCCACAAAATGGTGAAGCGTTATGTC
ATGTCAAGCATGTTGGGTACTTCTGCACAGAAACAATTTCGTGACATAAGAGATATGATG
ATCCATAACATGTTAAGCACTTTTCATAAACTGGTGAAAGATGACCCACATGCTCCTCTG
ATATTCAGAGATGTTTTCAAGGATGAGCTATTCCGGTTGTCCATGATCCAGAGCTTAGGA
GAGGATGTGAGTTCAGTCTATGTGGATGAATTTGGGAGGGACATTTCGAAGGAAGAAATC
TACAATGCTACTGTGACCGACATGATGATGTGCGCAATTGAGGTCGACTGGAGAGATTTC
TTCCCCTACCTCAGCTGGGTTCCAAACAAGAGCTTCGAAACAAGAGTGTTTACTACAGAA
ACTAGACGAACTGCGGTGATGCGCGCCTTGATCAAGCAGCAGAAGGAAAGGATTGTGCGT
GGAGAGGCAAAGACATGCTATCTGGACTTCTTGCTGGCAGAGAACACACTGACAGATGAG
CAACTGATGATGCTAGTGTGGGAGGCACTCATAGAGGCTGCAGATACTACCTTGGTCACC
ACAGAATGGGCCATGTATGAGCTTGCCAAGAACCCTGACAAACAGGAACGGCTTTACCAA
GAGATCCGGGAGGTGTGCGGCGACGAGACGGTCACCGAGGAGCACCTCCCACGGCTGCCG
TACCTCAACGCCGTCTTCCACGAGACGCTGCGCCGCCACTCCCCTGTCCCGCTCATACCT
CCGAGGTTCGTCCACGAGGACACCAAGCTCGCTGGCTACGACGTCCCCGCCGGCACCGAG
ATGGTGATCAACCTGTACGGGTGCAACATGAACAGGAAGGAGTGGGAGTCGCCGGAGGAG
TGGGTGCCGGAGAGGTTCGCCGGCGGGAGGCTCGAGGTGGCGGACATGTACAAGACGATG
GCGTTCGGCGCCGGGAGGAGGGCCTGCGCGGGGAGCCTGCAGGCGACTCACATCGCGTGC
GCCGCCGTCGCGCGCTTCGTGCAGGAGTTCGGGTGGAGGCTGAGGGAGGGTGACGAGGAG
AAGGTGGACACCGTGCAGCTCACCGCCTACAAGCTCCACCCGCTTCATGTCCACCTCACG
CGCAGAGGAAGGATGTGA

Protein

506 aa

>Os06t0570100-01 Ent-kaurene oxidase (EC 1.14.13.78) (AtKO1) (Cytochrome P450 701A3).
MEAFVPGGAGAAAAAVGGFVAAAALAERAGVIAPRKRPNAPPAVPGLPIIGNLHQLKEKK
PHQTFAKWAEIYGPIYTIRTGASSVVVLNSTEVAKEAMVAKFSSISTRKLSKALTVLTRD
KSMVATSDYCDFHKMVKRYVMSSMLGTSAQKQFRDIRDMMIHNMLSTFHKLVKDDPHAPL
IFRDVFKDELFRLSMIQSLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDF
FPYLSWVPNKSFETRVFTTETRRTAVMRALIKQQKERIVRGEAKTCYLDFLLAENTLTDE
QLMMLVWEALIEAADTTLVTTEWAMYELAKNPDKQERLYQEIREVCGDETVTEEHLPRLP
YLNAVFHETLRRHSPVPLIPPRFVHEDTKLAGYDVPAGTEMVINLYGCNMNRKEWESPEE
WVPERFAGGRLEVADMYKTMAFGAGRRACAGSLQATHIACAAVARFVQEFGWRLREGDEE
KVDTVQLTAYKLHPLHVHLTRRGRM*

5'UTR

chr06:22082399..22082485 (- strand) : 87 bp

CDS

chr06:22082272..22082398 (- strand) : 127 bp

chr06:22076480..22076640 (- strand) : 161 bp

chr06:22076224..22076385 (- strand) : 162 bp

chr06:22075929..22076069 (- strand) : 141 bp

chr06:22075591..22075845 (- strand) : 255 bp

chr06:22075315..22075474 (- strand) : 160 bp

chr06:22075022..22075215 (- strand) : 194 bp

chr06:22074137..22074454 (- strand) : 318 bp

3'UTR

chr06:22073976..22074136 (- strand) : 161 bp

FASTA

>Os06t0570100-01 class=Sequence position=chr06:22073976..22082485 (- strand)
GCGAGTTGTC GCTTTTCCTC CCCAACTCCA CGATCGAGTG AAGCGGACGA GGGCGACGGC GGCGAGCGCG CGCACAGCGT
GTGATCCATG GAGGCGTTCG TGCCGGGCGG CGCGGGGGCG GCGGCGGCGG CGGTCGGAGG GTTCGTCGCC GCGGCCGCGC
TAGCCGAGAG GGCCGGCGTG ATCGCGCCAA GGAAACGCCC CAACGCGCCC CCAGGTCAGC CGCCCCCCCC CCCCCCATCT
CTCAATCTCT CTCTCACTCA CTCACTGTCA CTGTTTGATG GAATGCCGCC TTGGTGAGTG GTGGGGATTG GCACTTACCA
TCGGTGGAGA GGGGTGAGAT TCGCATCGCA CCGGGAATCA ACAGGAAGTG GCCTCGCCGC CATCTCATCC ATCGCGGTCG
CGCCAGGccc cgccgacgag gtccgggccg cacggcgctc gccggaccac ggcttggtgc tgcccacggg cgcacccccc
cagccggcgc agatggagcc gctcggcgct cgtcgtcgca cgcgtgctcc acctcgccgt ctccgccatc gccggcaccc
actcacacgc tccctcgccg ggagagatcg gggagaagag aagaatagaa agggggatta gggtttacct cagccgccgg
cgatttctcc ggcacggggg agatcctggc cgtccaacag atcggacggt cgacctcgct cccgcgttgg cccgctgtgc
taatgggccc acccgatttc atgggccttc cgcttccgca ccacctgggc cgcgccgccg cagctcttag cccgcgcgca
catGCGGCAC GAACGCCTCT TGCCCCATTT CCACCGCCCT CTCCCGCTTC CGGCGATGTC CACGCCGAAC AGCCTCACGA
CACGTGCTGC TTCGCTGCTT GTAATTGGCT TCTCGTCGCC GGTGGCCGCC GCCGTGTTGT TCTTCTAGCA GTCGATGAAG
AGCAGCTCGT CGGCGCAGAG GCCCTTCTCC CTCACGAATC GGCTCCATCC CTTGGTCAGC ACGTAGCTCT GGCTGCTGTT
CCTGGACGAG TCACAGGTGG AGAAACCttt gtattccggt tcgtaacacc aatcgggact aaagttagga tctttaGTTT
GTACTCCCGG CGGGGTCGGG GCAGCAGCGG TGGCGGCAGT TGGAGGGTTT GTCGCTGCGG CCGCGCTCGC CGAGAGGGCC
GGCGTGATCG CGCCAAGGAA ACGCTCCAAC GCGCCCCCAG GTCAGCCGCC CCCCCACCAA TCTCTGCATC TCTCTCACTC
ACCCGCTGTC ACTGTTTGAT GGAATGCCGC CTCGGTGAGT GGCGCGCGAT CGGCGAATTG GTGGAGAGAG GTGAGATTCG
CATCGCACCG GTGAGTTTCT GAGGAATTGG AGATGTGTGT TGCTGCTTGA AATCAAAAAC TCTGATCTCT TGATTCCCTT
TGAAGATTTG AGAGCCAATC AAGTTTGCAT TCGCCACAAT TTTCGCACCG TTCTCCGTCA CTGTCTCTTC TCACTCTCTG
TCTCTTGATC TCTCCATTGA TATCACTCGG AGACGGAGGC GGAGACGGAG ACAGCGGTTG ATGCCACTGC TCGCGTAGGA
ACATCTTGAA TTTTCTCCCC TCCTTTTTGA TCTCCCTTTG ATGGAAACAG AAGCTTTTGT CCTGCCTTTA GGCAGAGACG
ATCAGAAGAA TCTATCCTCT CCTTTGCTTT ACATTGCCTT TTTTTCCTTT TCTTCATGTT ATTCTTTTTT TCTATTCAAG
TAGAACGATA TACCTCGTGG TGATCATGGT AGAGACCGAA AATGTAAAGC ATTTCCATTA TCTGCGAACA GAATGATGGG
ATGTTTAGTA TTTTCTCAAA CAAACATAGG CATTGCACTG ACAGGATTGA ATTCTAAATA AAGGAATAAA TAAAAGATGG
GCCAAATTGT TTCGAGAATC ACTGGACCAC ACTTTGAATT GTTTGGATGA AATTTACCCG TATGTTTGCA ACCGCTACAT
GTTAGGCCCA GTAAcctcta ttaagggaat tcgtttcatt tttttccaca aaaaatgttt cacctagtat attcacaatg
tttcactatg tataaatcta atgttttaat aaattgaaac atttttttgc aacaaatcac ccacatattt agaaaccctc
tattaaggga attcgtttct ttttttgttc caccaaaaat atttcaacta gtgtatttat aatgtttcac tatgtataga
tcaaatgtta cagtgaactg aaacattctt tcgttgttga aacattgttt ttatataaag tgaaacaacg tctagtttaa
acgattgaaa cattttcgat ctacttattg aaacaattct gatatacttg gtggaacatc gtgcaacatt taaaaataat
tcaataataa gctaaatttt tttttgtcag aatatatcca tatatggtct tgttttaaag atttaattgc aacgaattta
atggtgcaat cgaatcatga tttaatttgg ataaataatt taagagaaaa aatagtttaa agtggttttg caCGCATGCG
TCATGCTGAT GTCAGCGCCC GATTTTTCCC CTCCCTAATC GGACGCCCGA TGCGTAGGCT CCTCCATTCT TTTCTTAGAT
TAAAGAAAGA AAACAAAATA GTACTATAAC AATATTCCCT AAGCTCTTGT AGTTAGATGC TATTTTAGAA CATGTTAAAA
CACGTCGTTT TCATCATCGG GATAACAAAA AAATAAATAA ATTAATTAAT GGCCGTATTT TTTTTTAAAA AAAACGAATC
TCGTTCTTTA TATGGCCTAG TCTCGTATGG ATGGACGTGC AACCGCGCGA CGCGAGTTGT CGCTTCTCCT CCCCAACTCC
ACGATCGAGT GAAGTGGGCG ACGGCGGCGA GCGCGCACGC AGCGTGTGAT CCATGGAGGC GTTCGTGCCG GGTGGCGCGG
GGGCGGCGGC GCCGGCGGTG GCGGCGGTCG GAGGGTTCGT TGCCGCGGCC GCGCTCGCCG AGAGGGCCGG CGTGATCGCG
CCACGGAAAC GCACCAACGC GCCCCCAGGT CAGCCGCCCC CCATCTCTCT CACTAACTCG CTGTAATTGT TTGATGGAAT
GCCGCCTCGG TGAGTGGCGC GCGATTGGCG AATGACTCAC TCACGATTGG TGGAGACAGG TGAGATTCGC ATCGCACCGG
TGAATTTTCC GACGAATTGG AGAGTTGTGT TTCTACTACT TGAAATCAAA ACCTCTGATC TCTTGATTCC CTTGAAGATT
TGAGAGCCAA TCAAGTTTGC ATTCGCCACA ATTTTCGCAC CATTCTCCGC CGCTGTCTCT TCTCACTCTC TCTCTCTCTT
GATCTCTCCA TTGATATCAC TCGGAGACGA AGACGGAGAC AGCGGTTGAT GCCGCTGCTC GCGTCGGAAC ATCTTGAATT
TTCTCCCCTC CTTTTGATCT CCCTTTGTTG GAAACGGAAG CTTTTGTCCT GCCTTTAGGC AGAGACGATC AGAAGAATCT
ATCCTCTCCT TTGCTTTACA TTGCCTTTTT TTTTCCTTTT CTTCAAGTTA TTCTTTTTTT TTCTTCTATT CAAGTAGAAC
GATATACCTC GTGGTGATCA TGTCAGAGAC CGAAAATGTA AAGCATTTCC GTTATCTGCG AAGAGAATGA ATGAATTTTC
TGCACTAACA GGATTGAATT CTAAATAAAG GAATAAATAA AAGATAGGTC AAATTGTTTC AAGAATCGCT GGATCACACT
TTGAATTGTT TGGATGAAAT TTACCAAAAA GCAAGTTGCT CTTCAGAGGG CATGCATTCA TGCCCTTCAA TAGGGCGTAG
CAAGGAATTA GAGGTCCTGG TGCGAAAGGT ATAATGGGAC CTCAACATAT GATTACATCT AGTTCTAATC GATTTAGCTT
TAGATATTAA GCCCTGTTGT GCCTTCTACT TTTAGTTTTG GGTCTTAGGT TCTCTGACCG TCTGGGCTTT AGCATTTTAG
TTATGCTGCT AATTAAGtac tccctctgtc cctaaaaaat caacatagta ccagatgtgt cacatcgtat tactataaat
ctggacatag atctatcata ttcgtagtac tatgatgtat cataccggta ctatgttgat tttttatgtg acggaagaag
taTATACTTA GCACTTCATG TAATTAAGAT TTGGGGCTGA ACAATCGCAC ACCTCACTAT GTTACTGTAC GGCCTGTTCT
CCAAACAGAC AGCCCTTTCT CTCTCGCTAT TACCAAAATT TCAGACGATT TTTTTATATT TGGAATTTCG AATATTTTTT
CATGAATTTG ATCCCCCCTC CTCCCGTAAA TTCAAACAAA TTTAAAATTT TTATGCCAGA GGCATTTCCT GCTTACTGGT
ACCTTCAAAT TAACCGGTGC TGGATTACAG ATAGAGGATG AGCCGAGGGG TTTGGCGGTA GCTTGCTTGT TTGCAGATAA
TAATTTTATT TAAACATATA AATTTGTATG AAGCATAAAG CGGAACGCCT TTCTTACCAG TGACTTACTG TAGCCTTCCG
TTTATTTTTG GCTGGGAGCG TGATTTTTCA GTTGCAACTG TAGAAATTGA TTTTTCAATT GCAGTAGCTT TTCCCAAAGC
TATCCTCATC GGACCACTTG GATAGCAGTT TTTTTGGTAA TTATTGTTCT CTTGATTTTT TTCTCTAGCA CATTAGTTCT
TCTGATTAAC GTAGTGTGGA TTTGAAAATT AGGAAACTAT CATAGAGTGA AACATTCTAA GTAAAGAATT TAATGATATC
ACATAGAGAC TAGCTTTTTG TATAGTATGT CATAACCTTA ACAAACTTTA GAAAACTTTC ATTAATCCAT AAAAAGCTTC
CAAATTTGTT CCTCTGTTTT ATAAAGATTT CGTGCTGTGT TAGCTTGCGC TTATTGCCCC ATGATGATGG AAGGACATAC
ATCTGTTTTC CATTAACAGC CAATAAATTC ACATAACTCG CGTTATTACT TTGCAAACAT AACTGAAATG ACATTCCCTA
AATTTGTCGA TTGTTTTTCA ATCTTCCTTT TGATATATCA AAATTTTAAA AAAGTAAATA TAGTATAAGT AGACAAAAGA
CTCCCACTTT CACTGGAGAC ACATGGTACA TCATGTGTTC GTGGAACAAC ATCGACAATA TGTACTTAAC CAAACCCAAT
CGGCATGTCT ATGCGAATGG CAGAATGTGT ATGGACAGCA CCAAGAGTCC AAGGCAGAAA AAAAAGGAGA GTAAATGGCA
TAATAAATAA AGAAAAACCT GATGACCCAT AGAAACGAAC AGGAGAATTT TGAAAATATT CAGATCAGCG CTATTCATTT
TGATTTTTTA TAAGTCAAAC TTCTTTAGGT TCAATCAAAT TGaaataaag aaactatgaa aatatgttca atgtagataa
actaatttag ttctataagt attgctatat tttttttata aacttgatca aactttcaag aagtttgatt taaagaaaaa
gtcaaaacaa tttataatat gaaacagatg gagtGTATAT ATTTTGTTGA CCCACTTGTG AGTTGAGAGT GCAAAGTATT
AATTATTGTG GTCTATAGTC ACCTAATTCT ATTCGACCAT CATCATGTCA ATATCTGACA AAATCTGACA ACATCACCGA
AGAAAGGGAC AACACTAATT CATCACTAGG CTAGTTACTT GCATGAATAT ATGGTGTTAT CATCTATGCA AACAAATTAT
CAGAATAACT CATTTCAAGT TTTTAGTCTA GTGTGCAAGT TCTAAGTCTC CTATGATTCT ATGATTCTAT TTCATTGTCA
TGCAGCTGTT CCTGGTTTAC CCATTATCGG AAATCTGCAT CAACTGAAAG AAAAGAAGCC TCATCAGACC TTTGCAAAAT
GGGCTGAAAT TTACGGGCCA ATCTACACTA TAAGAACCGG GGCTTCTTCT GTAGTTGTGC TCAATTCAAC TGAAGTAGCC
AAGGAGGTAA CTTGGAAGTT GTCTATCATT TTTATTGACT TGCATAGCTC AAGAATGATA GTCTCAAGAA ACCATGGATT
TACTGTACTC TCTTTTGCAG GCGATGGTTG CAAAATTCTC ATCCATATCT ACCCGAAAGC TATCCAAAGC ACTGACAGTG
CTTACTCGTG ATAAATCCAT GGTTGCTACC AGCGACTATT GTGATTTCCA CAAAATGGTG AAGCGTTATG TCATGTCAAG
CATGTTGGGT ACTTCTGCAC AGGTATACTT CTCAACAATT TCATTTTTCA TTTTTAGTAC TGATTATTCT CAATAACTCC
AGTGTGCATT TTCAGATTTT ATTATCTGCT ACCAGTTACA CTTTCAGAGT TTCAGTATCT GTGGTCTGAC AACGCAAATG
CTTCCATAAA TTTCAGAAAC AATTTCGTGA CATAAGAGAT ATGATGATCC ATAACATGTT AAGCACTTTT CATAAACTGG
TGAAAGATGA CCCACATGCT CCTCTGATAT TCAGAGATGT TTTCAAGGAT GAGCTATTCC GGTTGTCCAT GATCCAGGTT
TGGATTGTCT CTCTGAACTT GAACTGTCAG ATGGTCGATT TGTTATTTCT GGCACTAACA ATTAATGTCG CAAACTTCAG
AGCTTAGGAG AGGATGTGAG TTCAGTCTAT GTGGATGAAT TTGGGAGGGA CATTTCGAAG GAAGAAATCT ACAATGCTAC
TGTGACCGAC ATGATGATGT GCGCAATTGA GGTCGACTGG AGAGATTTCT TCCCCTACCT CAGCTGGGTT CCAAACAAGA
GCTTCGAAAC AAGAGTGTTT ACTACAGAAA CTAGACGAAC TGCGGTGATG CGCGCCTTGA TCAAGCAGCA GAAGGAAAGG
ATTGTGCGTG GAGAGGTGAG GAAAGGCATA CTTTGACAAA TGACATCTTT CATATTTGCT TCTATGCCAA AAAAAAAAAA
AAACTTGCAG AGATCATCTT TTAACTCCAT GAAACTGAGA TATATGTGCA GGCAAAGACA TGCTATCTGG ACTTCTTGCT
GGCAGAGAAC ACACTGACAG ATGAGCAACT GATGATGCTA GTGTGGGAGG CACTCATAGA GGCTGCAGAT ACTACCTTGG
TCACCACAGA ATGGGCCATG TATGAGCTTG CCAAGAACCC TGACAAACAG GCAAGAAATA TTGTTACTCT GTTCCAGCTC
ATTGTTGGCA TTCTTGGCAT TATCAACCAA AGCTTTTTAT TTTTGGCCTT CTTCTTGTTG TCATGCCAGG AACGGCTTTA
CCAAGAGATC CGGGAGGTGT GCGGCGACGA GACGGTCACC GAGGAGCACC TCCCACGGCT GCCGTACCTC AACGCCGTCT
TCCACGAGAC GCTGCGCCGC CACTCCCCTG TCCCGCTCAT ACCTCCGAGG TTCGTCCACG AGGACACCAA GCTCGCTGGC
TACGACGTCC CCGCCGGCAC CGAGGTAAGC ACAACCACTC GGGCCGAAAC TTTCGTGTTT TCGGTACTTG TTTTGCACGA
AATTATTTGA GTTTTTAACC GAATTTGTAT AAAATTTTGA CCAAATTCAC AAAACTTTGG AAAATTCTGA AAATTTTGGG
CGTTATTTTT AAGATAATTG ATAGAAATCT GACCTCTATA TCCACAGTGG ACCATAAGAA AACAAGCTTT GAATAAAAAT
AACACAAGAT TAAGCTACAC TTTTCTTCTA TATCCTTGTT TCAAACCTGC CTTGGCACAT CCCGTTGAAA TCCAAtactc
cctctgtcct aaaatataga agcctagaat cggatatgac atttcctcta tcctaatact aggaaatttt ctatcatgtg
ctaggttctt atatttttgg acggagTATT TTTTATCATA TCAGGCAAAC TTGTCGTTCT TGACTTCTCG TAGAGTTTTC
GGGTGGGATA TAATTGCTTG CCTGGGGAGT CCAAAATTTT AATCACTGGT CAACTCGCCG ATCAGTGATC AAAATCCCCT
AACAATCTAA CAAGTGATGG TCATGTGGCA GATGGTGATC AACCTGTACG GGTGCAACAT GAACAGGAAG GAGTGGGAGT
CGCCGGAGGA GTGGGTGCCG GAGAGGTTCG CCGGCGGGAG GCTCGAGGTG GCGGACATGT ACAAGACGAT GGCGTTCGGC
GCCGGGAGGA GGGCCTGCGC GGGGAGCCTG CAGGCGACTC ACATCGCGTG CGCCGCCGTC GCGCGCTTCG TGCAGGAGTT
CGGGTGGAGG CTGAGGGAGG GTGACGAGGA GAAGGTGGAC ACCGTGCAGC TCACCGCCTA CAAGCTCCAC CCGCTTCATG
TCCACCTCAC GCGCAGAGGA AGGATGTGAA CCATTATATT CATTGGAAGC TGTTGCTCGT TGAATAATGA TATATAGTTA
TCTTTGAGAT GTATTTACTA TTAGCAAAAT CTCCATGCTT TGTTATGGAT AGGAGAAAAC ATATTATAAT ATATCATGGA
CTATATTTCT TTTATCAAAT ATGGTTGTAT 

Locus: Os06g0570100

Loading...

Locus: Os06g0570100

Loading...