Os06t0571800-02

Locus

Os06g0571800

Description

Similar to GATA transcription factor 3 (AtGATA-3).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA16

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 16

Oryzabase Gene Symbol Synonym(s)

OsGATA16, OsGNC, GNC

Oryzabase Gene Name Synonym(s)

GATA transcription factor 16, GATA factor 16, "GATA, NITRATE-INDUCIBLE, CARBON-METABOLISM INVOLVED"

Transcript Evidence

AK069851 (DDBJ, Best hit)

Protein Evidence

B6SS40 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

Zinc finger, NHR/GATA-type (IPR013088)

Full-length cDNA

J023034D16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0571800-02)

RiceXPro (AK069851)

Others

Oryzabase (20499)

KEGG (Os06t0571800-02)

Transcript

1633 bp

>Os06t0571800-02 Similar to GATA transcription factor 3 (AtGATA-3).
AATCGTGCTGGACCTCGCAAAATTGCCCCTCCAACCGCATCAACACTCGTCGCGCGAAGC
GTACCATCGTCTCTCTCATCTTCCTCGCGGTCTCATCCTGATCGATCTCTGCGAGTTTAT
CCAATATCTGTACTCGCAAACTAGCTAGAGAGATCTAGTTAGTAGCTAGGCAGTTGCTGC
CTCTCATGTCTACCATCTACATGAGTCAGCTCTCAGCTGCTCTCCCTCTCATGGAGGGGG
AGCACCACCATCACCACCAGGATCATCACCAAGGCCACTTCCAAGCCTTCTCCCTGCAGC
CTAAGGATCCCCCAGTCTTATTCCCCTTTGTGATCAGTAGAAGAAGCAGCAGCAGCAGCC
CTAGCGACAGCACCACTCTAAGCTATGGTTCAGACCATCACTTGACACAGCAGCAGCAGC
ATCAGCATCAAGCCATGCTTGAGCCCCAAAATATGATTGGAGGATCATCCGCTGGCATCT
TTGCGACGCCGTTCCCGACCGTCAAGAGCATCCGCGACGACATGATCGAGCGGTCGCAGT
TCGATCCATACGATACCGAGAAGCTGCAGGCGAGCTGCGGGTTAGCCAAGGTCGTCGCCG
GCGGCAAGTGGAGCGCGGTGCCAGCGGCCAAGATGAAGATCACGAGGAAGATGGGTGAGC
CGTCGTCCGGTGTCACTGGcggggctgcgacgacggtggcgccgaagaagccgaggagga
ggccggcgcaggcgtacgaggatcacggccatggcggcgcCATGGGCCAAGCTTTTGGCG
TGATTAGGGTGTGCTCCGACTGCAACACCACCAAGACTCCCTTGTGGAGGAGTGGCCCGT
GCGGCCCCAAGTCGCTTTGCAACGCGTGCGGCATCAGGCAGAGGAAGGCGCGGCGGGCGA
TGATGGCCTCCGGACTACCAGCGTCCCCCAACGCCGCCGGCCCCAAGGCGGCCGCACATA
GCGGCGCCACAAACGCAGCCGCCGCAGCTGCCATGGAGGAGACGGCCGAGTCCGCCACCG
TCGCCCCGCCCCCGGCGCCGACGACGAGGGGTGGTACTCTCGTCGACAGCATCGGGCTCA
GCTGGAGCAAGACCCATGCCGCCGCCACCGCCTCCTGCAGCTTCCGGCCGTCACCGGTGG
CTCCCGGCTTCGCGGCGGCGGTGCAGGACGAGATCACTGACGCCGCCATGCTGCTCATGA
CGCTGTCCTGCGGGCTTGTCCGGAGCTGAGAAAGAAAAGCTATACTTCATCTCTGCATGC
ATCCATCGATCGATCGATTGGCACCAAGCTAGAGAGACCAATCGATGGAGATGGAGAGAG
GTGCAGGCTTTTTGCAGCTAGTGCGTTAGCCTGTTCTTGCTCGCTCGATCGATCGTACAC
TGCCCCCCAGTTGGAATGTCTCTTGGCGTCTTGTTTCCTGTTCGAGTCTTGTGATCTCTG
TTACTTTGTGCACTGTACTAGAGAGTGAGAGAGAGAGTGAGGTAGAAACATCAAGAGGAG
ATTAGAGGAGAAAGAATAATTAAGAGAAAAGTGTGAGCTAGCTAGGTAAGATTTACTGTA
CTGTGAGTTCAATTTGGAGTAAGCTTTTTTGGGCTGCTTCACGGCTAATTATGCCACTGG
CTGCTATATATGT

CDS

1044 bp

>Os06t0571800-02 Similar to GATA transcription factor 3 (AtGATA-3).
ATGTCTACCATCTACATGAGTCAGCTCTCAGCTGCTCTCCCTCTCATGGAGGGGGAGCAC
CACCATCACCACCAGGATCATCACCAAGGCCACTTCCAAGCCTTCTCCCTGCAGCCTAAG
GATCCCCCAGTCTTATTCCCCTTTGTGATCAGTAGAAGAAGCAGCAGCAGCAGCCCTAGC
GACAGCACCACTCTAAGCTATGGTTCAGACCATCACTTGACACAGCAGCAGCAGCATCAG
CATCAAGCCATGCTTGAGCCCCAAAATATGATTGGAGGATCATCCGCTGGCATCTTTGCG
ACGCCGTTCCCGACCGTCAAGAGCATCCGCGACGACATGATCGAGCGGTCGCAGTTCGAT
CCATACGATACCGAGAAGCTGCAGGCGAGCTGCGGGTTAGCCAAGGTCGTCGCCGGCGGC
AAGTGGAGCGCGGTGCCAGCGGCCAAGATGAAGATCACGAGGAAGATGGGTGAGCCGTCG
TCCGGTGTCACTGGcggggctgcgacgacggtggcgccgaagaagccgaggaggaggccg
gcgcaggcgtacgaggatcacggccatggcggcgcCATGGGCCAAGCTTTTGGCGTGATT
AGGGTGTGCTCCGACTGCAACACCACCAAGACTCCCTTGTGGAGGAGTGGCCCGTGCGGC
CCCAAGTCGCTTTGCAACGCGTGCGGCATCAGGCAGAGGAAGGCGCGGCGGGCGATGATG
GCCTCCGGACTACCAGCGTCCCCCAACGCCGCCGGCCCCAAGGCGGCCGCACATAGCGGC
GCCACAAACGCAGCCGCCGCAGCTGCCATGGAGGAGACGGCCGAGTCCGCCACCGTCGCC
CCGCCCCCGGCGCCGACGACGAGGGGTGGTACTCTCGTCGACAGCATCGGGCTCAGCTGG
AGCAAGACCCATGCCGCCGCCACCGCCTCCTGCAGCTTCCGGCCGTCACCGGTGGCTCCC
GGCTTCGCGGCGGCGGTGCAGGACGAGATCACTGACGCCGCCATGCTGCTCATGACGCTG
TCCTGCGGGCTTGTCCGGAGCTGA

Protein

347 aa

>Os06t0571800-02 Similar to GATA transcription factor 3 (AtGATA-3).
MSTIYMSQLSAALPLMEGEHHHHHQDHHQGHFQAFSLQPKDPPVLFPFVISRRSSSSSPS
DSTTLSYGSDHHLTQQQQHQHQAMLEPQNMIGGSSAGIFATPFPTVKSIRDDMIERSQFD
PYDTEKLQASCGLAKVVAGGKWSAVPAAKMKITRKMGEPSSGVTGGAATTVAPKKPRRRP
AQAYEDHGHGGAMGQAFGVIRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKARRAMM
ASGLPASPNAAGPKAAAHSGATNAAAAAAMEETAESATVAPPPAPTTRGGTLVDSIGLSW
SKTHAAATASCSFRPSPVAPGFAAAVQDEITDAAMLLMTLSCGLVRS*

5'UTR

chr06:22155054..22155238 (+ strand) : 185 bp

CDS

chr06:22155239..22155505 (+ strand) : 267 bp

chr06:22155629..22156027 (+ strand) : 399 bp

chr06:22156132..22156244 (+ strand) : 113 bp

chr06:22156374..22156638 (+ strand) : 265 bp

3'UTR

chr06:22156639..22157042 (+ strand) : 404 bp

FASTA

>Os06t0571800-02 class=Sequence position=chr06:22155054..22157042 (+ strand)
AATCGTGCTG GACCTCGCAA AATTGCCCCT CCAACCGCAT CAACACTCGT CGCGCGAAGC GTACCATCGT CTCTCTCATC
TTCCTCGCGG TCTCATCCTG ATCGATCTCT GCGAGTTTAT CCAATATCTG TACTCGCAAA CTAGCTAGAG AGATCTAGTT
AGTAGCTAGG CAGTTGCTGC CTCTCATGTC TACCATCTAC ATGAGTCAGC TCTCAGCTGC TCTCCCTCTC ATGGAGGGGG
AGCACCACCA TCACCACCAG GATCATCACC AAGGCCACTT CCAAGCCTTC TCCCTGCAGC CTAAGGATCC CCCAGTCTTA
TTCCCCTTTG TGATCAGTAG AAGAAGCAGC AGCAGCAGCC CTAGCGACAG CACCACTCTA AGCTATGGTT CAGACCATCA
CTTGACACAG CAGCAGCAGC ATCAGCATCA AGCCATGCTT GAGCCCCAAA ATGTAAGCTC TACCGTCTAA TCTGTACCTA
TATGTAGCTA TAGCTAGGGG TTCAAGTCTT AATCATGTGT TGATTTGTCA AATTGTTTGT TTGACATGTT AATTCTTCTG
CTGTTAAATC ATCAGATGAT TGGAGGATCA TCCGCTGGCA TCTTTGCGAC GCCGTTCCCG ACCGTCAAGA GCATCCGCGA
CGACATGATC GAGCGGTCGC AGTTCGATCC ATACGATACC GAGAAGCTGC AGGCGAGCTG CGGGTTAGCC AAGGTCGTCG
CCGGCGGCAA GTGGAGCGCG GTGCCAGCGG CCAAGATGAA GATCACGAGG AAGATGGGTG AGCCGTCGTC CGGTGTCACT
GGcggggctg cgacgacggt ggcgccgaag aagccgagga ggaggccggc gcaggcgtac gaggatcacg gccatggcgg
cgcCATGGGC CAAGCTTTTG GCGTGATTAG GGTGTGCTCC GACTGCAACA CCACCAAGAC TCCCTTGTGG AGGAGTGGCC
CGTGCGGCCC CAAGGTACTT ATATACCTCT TCGTCTCACT CATGGCCATG GCGCCATGGA TGCTTTTGCT TGCGTATACT
GCAGCTGTGT CTCATTTCAT GGCTGTTCCA TGGTGCAGTC GCTTTGCAAC GCGTGCGGCA TCAGGCAGAG GAAGGCGCGG
CGGGCGATGA TGGCCTCCGG ACTACCAGCG TCCCCCAACG CCGCCGGCCC CAAGGCGGCC GCACATAGCG GCGCCGCTGC
GGTGGCGGCT GCGCAGCCGA AGGTGAAGAA GGAGAAGAGA GCCGACGTCG ACCGGTCGTC GCTGCCGTTC AAGAAACGGT
GCAAGGTCGT CCAGGTCGAG GATCATCAAA CGCTGCCCGC CGCCACAAAC GCAGCCGCCG CAGCTGCCAT GGAGGAGACG
GCCGAGTCCG CCACCGTCGC CCCGCCCCCG GCGCCGACGA CGAGGGGTGG TACTCTCGTC GACAGCATCG GGCTCAGCTG
GAGCAAGACC CATGCCGCCG CCACCGCCTC CTGCAGCTTC CGGCCGTCAC CGGTGGCTCC CGGCTTCGCG GCGGCGGTGC
AGGACGAGAT CACTGACGCC GCCATGCTGC TCATGACGCT GTCCTGCGGG CTTGTCCGGA GCTGAGAAAG AAAAGCTATA
CTTCATCTCT GCATGCATCC ATCGATCGAT CGATTGGCAC CAAGCTAGAG AGACCAATCG ATGGAGATGG AGAGAGGTGC
AGGCTTTTTG CAGCTAGTGC GTTAGCCTGT TCTTGCTCGC TCGATCGATC GTACACTGCC CCCCAGTTGG AATGTCTCTT
GGCGTCTTGT TTCCTGTTCG AGTCTTGTGA TCTCTGTTAC TTTGTGCACT GTACTAGAGA GTGAGAGAGA GAGTGAGGTA
GAAACATCAA GAGGAGATTA GAGGAGAAAG AATAATTAAG AGAAAAGTGT GAGCTAGCTA GGTAAGATTT ACTGTACTGT
GAGTTCAATT TGGAGTAAGC TTTTTTGGGC TGCTTCACGG CTAATTATGC CACTGGCTGC TATATATGT

Locus: Os06g0571800

Loading...

Locus: Os06g0571800

Loading...